KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0492Help
Entry
PSTAB_0492        CDS       T01571                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00230  Purine metabolism
psz01100  Metabolic pathways
Module
psz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSTAB_0492
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PSTAB_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 AAA_16 MMR_HSR1 RsgA_GTPase cobW ABC_tran AAA AAA_30
Motif
Other DBs
NCBI-ProteinID: AEJ03773
UniProt: F8H7Y0
Position
complement(540439..541059)
Genome map
AA seq 206 aa AA seqDB search
MSATTGTLYIVSAPSGAGKTSLVKALVDAQPQVRVSVSHTTRAMRPGEVDGVNYHFVSRD
EFLARLERNEFLEHAEVFGNLYGTSQRWLEQTLAEGYDLILEIDWQGAQQVRRLMPQAQS
IFILPPTQEALRQRLNNRGQDSDEIIEKRMREAVSEMSHYVEYDYLVINDDFAHALIDLQ
SIFRANQLKQQAQQQRHARLLSELLA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaccaccggtacgctctatatcgtttccgcgccttccggggccggcaagacc
agcctggtcaaggccctggtcgatgcacagccgcaggtgcgggtgtcggtctcccacacc
acccgcgccatgcgtccgggtgaggtagacggggtcaactatcacttcgtcagccgcgac
gaattcctcgcgcgcctggagcgcaacgagtttctcgaacacgccgaagtgttcggcaac
ctttacggcacctcccagcgctggctggaacagacgctggccgagggctacgacctgatc
ctcgagatcgactggcagggcgcgcagcaggtgcgccggctgatgccccaggcgcaatcg
atcttcatcctgccgccgacccaggaggccctgcgccagcgcctgaacaaccgcggccag
gacagcgacgagatcatcgagaagcgcatgcgcgaagcggtcagcgagatgagccactac
gtcgagtacgactacctggtgatcaacgacgacttcgcccacgcgctgatcgatctgcag
tcgatcttccgcgccaatcagctcaagcagcaggcccagcagcagcgccatgcgcgcctg
ctcagcgagttgctggcctaa

DBGET integrated database retrieval system