KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0506Help
Entry
PSTAB_0506        CDS       T01571                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_0506
   00030 Pentose phosphate pathway
    PSTAB_0506
   00051 Fructose and mannose metabolism
    PSTAB_0506
   00052 Galactose metabolism
    PSTAB_0506
   00500 Starch and sucrose metabolism
    PSTAB_0506
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAB_0506
  Nucleotide metabolism
   00230 Purine metabolism
    PSTAB_0506
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSTAB_0506
Enzymes [BR:psz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSTAB_0506
    5.4.2.8  phosphomannomutase
     PSTAB_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(552331..554901)
Genome map
AA seq 856 aa AA seqDB search
MALFKRTAKDSGVLNPAETRSKRSGINIKPLLGGLASCLIGLGAAAALLWLGLQNAEQEQ
RTQLASAWGQSQASALQQALRQLQGDTQAVTERLMLVDALRGDGERRRDAEQRLLDLPGV
VDAHLNVRGRAVPDTSRPGPLNFAALDLLQRAEAGQAPAPEAYKVDNRWLLYSAVALRGE
GQQAIRGTLLLVTDLERLLAGLPTLPAGAGQLRLSQQFAGAPEQVLLQRGTPGNATALTL
PSGNSNWTLSYVPGSEAAPAMLTPLHLIAAALLALAGVLIGLQLVLGSQQRKLREDVLRI
SRLLQELSTGKTIQIPALSLPVLDALARNMVRLPVRPAGSAPTQAPAAAPAVRPAKPTEY
VAPPLPETDILDIDILDEDQDIFGLDTKERETAMSSAKAPNLPASIFRAYDIRGVVGDSL
TTETAYWVGRAIGSESLAKGEPNVSVGRDGRLSGPELVQHLIQGLLDSGCDVSDIGMVPT
PVLYYAANILAGKSGVMLTGSHNPPDYNGFKIVIAGDTLANEQIQVLRKRIETNDLSSGV
GKVEQVDVLERYFEQIRSDIAMAKPMKVVVDCGNGVAGVIAPKLIEALGCTVIPLYCEVD
GNFPNHHPDPGKPENLVDLIAKVKSEKADLGLAFDGDGDRVGVVTNAGTMIYPDRLLMLF
AKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKESGALLAGEMS
GHIFFKERWFGFDDGIYSAARLLEILSQDKRDAEQVFAAFPCDISTPEINITVTEESKFT
IMDALQRDAKWGEANLITLDGVRVDYPKGWGLIRASNTTPVLVLRFEADSEEELSRIQDV
FRGQLLSVAPDLKLPF
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcactcttcaagcgcaccgccaaggattcaggcgtactgaacccggccgagacccgc
agcaagcgcagcggcatcaacatcaaacccttgctcggtggcctggcgagctgcctgatc
ggcctcggcgcagcggcagcgctgctctggctgggcctgcagaatgccgagcaggagcaa
cggacgcagctggccagcgcctggggccagagccaggccagcgcgctgcagcaagcgctg
cgtcagctgcagggcgatacccaggcggtgacggagcgactgatgctggtcgacgcgctg
cgtggcgacggtgagcgtcgacgcgatgccgagcagcgcctgctggacctgcccggcgtg
gtcgacgcgcatctgaatgtccgcggccgcgccgtacccgacaccagccgcccgggaccg
ctgaacttcgccgcgctcgatctgctgcagcgtgcggaagccggccaggcgcccgccccc
gaagcgtacaaggtcgacaaccgctggctgctgtacagcgccgtcgccctgcgcggcgaa
ggtcagcaggcgattcgcggcacgctgctgctggtgactgacctcgaacgcctcctcgcc
ggcctcccgacgctgcccgccggcgccgggcaactgcggttgagccagcaattcgccggc
gcaccggagcaagtgctgctgcagcgcggcaccccgggcaatgccacggccctgacactg
cccagcggcaattccaactggacgctgagctacgttccgggcagcgaagccgcgccggcc
atgctgacgcccctgcacctgatcgccgcggcgctgctggcactggccggcgtactgatc
ggcctgcaactggtgctcggcagccagcaacgcaagctgcgcgaagacgtgctgcggatc
agtcgcctgctgcaggaactctccacgggcaagaccatccaaataccggccttgagcctg
ccggtcctcgacgcactggccaggaacatggtccgactgcccgtccgccccgccggatcg
gctccgactcaggcacctgccgcggcccccgccgtacggcccgccaaacctaccgagtac
gtcgctccgcccctgccggagaccgatattctcgacatcgacattctcgacgaggaccag
gacatcttcggcctcgacaccaaggagcgagaaaccgcaatgagcagcgccaaagccccg
aacttgcccgccagtatcttccgcgcctacgacatccgtggcgttgtcggcgacagcctg
accaccgaaaccgcgtactgggtcggccgcgccatcgggtccgagagcctcgccaagggt
gaacccaacgtttccgtcggccgcgacggtcgcctgtccggcccggagctggtccagcac
ctgatccagggcctgctcgacagcggctgcgacgtcagcgacatcggcatggtgccgacg
ccggtgctctattacgcggccaacatcctcgccggcaagtccggggtgatgctcaccggt
agccacaacccgccggactacaacggcttcaagatcgtcatcgccggagacaccctggcc
aacgagcagatccaggtgctgcgcaagcggatcgagaccaacgacctgtccagcggtgtc
ggcaaggtcgaacaggtcgatgtactggagcgttacttcgagcagatccgcagcgacatc
gccatggccaagccgatgaaggtggtggtcgactgcggcaacggtgtggccggcgtcatc
gcgcccaagctgatcgaggccctgggttgcaccgtgatcccgctgtactgcgaggtcgac
ggcaacttccccaatcaccaccccgatcccggcaagccggagaacctggtcgacctgatc
gccaaggtgaaatccgagaaggctgatctgggcctggccttcgacggcgacggcgatcgc
gtcggcgtggtgaccaacgccggcaccatgatctacccggaccgcctgctgatgctgttc
gccaaggacgtggtttcgcgcaatccaggcgccgacatcatcttcgacgtcaaatgcacc
cgccgcctgaccccgctgatcagcggctatggcggccgcccggtgatgtggaagaccggc
cattcgctgatcaagaagaagatgaaggaatccggcgcgctgctggccggcgagatgagc
ggccacatcttcttcaaggaacgctggttcggcttcgacgacggcatctacagtgctgca
cgcctgctggagatcctcagtcaggacaagcgtgacgccgaacaggtgtttgccgccttc
ccctgcgatatctcgacgccggagatcaacatcacggtgacagaggaaagcaaattcacc
atcatggacgccctgcaacgcgacgccaaatggggcgaagccaacctgatcaccctcgac
ggtgtgcgggtcgactatcccaagggctggggcctgatccgcgcctccaacaccaccccg
gtgctggtactgcgcttcgaggccgacagcgaagaagagctcagccgcatccaggacgtc
ttccgcggccagctgctcagcgttgcacccgacctcaaactgccgttctga

DBGET integrated database retrieval system