KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0561Help
Entry
PSTAB_0561        CDS       T01571                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSTAB_0561 (hemD)
Enzymes [BR:psz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PSTAB_0561 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
610452..611222
Genome map
AA seq 256 aa AA seqDB search
MTGWRLLLTRPTEECEALAATLAEAGVHSSSLPLLVIEPLPESAEQRAMILELDRYCAVV
VVSKPAARLGLELLDRYWLQPPFGQAWFSVGGATGAILEAYGLDVSWPERGDDSEALLAL
PRLAQALARPDPKVLIMRGEGGREFLAETLRGRGVQVDFLELYRRSLPDYPPGTLVQVVR
SERLNGLVVSSGQGLLSLHELAADTWPELCELPLFVPSPRVAEMARQLGAKRIVDCRGAG
AAALLAALRETAVAAS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggctggcgcctgctgctgacccggccgaccgaggaatgcgaggcattggccgcg
actctcgccgaggctggtgtgcacagctccagcctgccgctgctggtgatcgagccgctg
ccggagtccgccgagcagcgtgcaatgatcctcgagctggatcgctattgcgctgtcgtc
gtggtcagcaagccggccgcccgcctgggcctggaactgctcgatcgctactggctgcag
cccccgttcggtcaggcctggttcagcgtcggtggcgccaccggggcgatcctcgaagcc
tacgggctggacgtcagctggcccgagcggggtgacgacagtgaagcgctgctggcgctg
ccacgattggcgcaggcgctggccaggcccgatccaaaggtattgatcatgcgcggcgag
ggcggccgcgagttcctcgccgagacgcttcgcgggcgtggcgtgcaggtcgactttctc
gaactgtaccgtcgcagcctgcccgactatccgcctggaacgctggtgcaggtcgttcgg
tcggaacggctcaacggcctggtggtcagcagtgggcagggtctgctgtcgctgcatgag
ctggcagccgatacctggcccgaattgtgtgagctacccttgttcgtacccagtccgcgg
gtggcggagatggctcgacagctgggcgccaaacgaattgtggattgccgtggcgcagga
gctgcggccttgctggcggccttgcgggaaaccgcggtggccgcttcctga

DBGET integrated database retrieval system