KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0613Help
Entry
PSTAB_0613        CDS       T01571                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSTAB_0613 (folK)
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PSTAB_0613 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673078..673620
Genome map
AA seq 180 aa AA seqDB search
MSLTPVLLGLGSNVQREPHLHAGLDALAELLVNMRCSPVFESLAVGYKGDNFYNLVVAGD
TELPLTELDRRLKFIEADNGRYAPDRKGLPLDIDVLLYGELVGNFHGLLLPRAEILKNAF
VLWPLALLAPTVRHPAADASFAELWAQSTIDQQLWPVPFQWRGAELTPPELVRAHPPRCA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctaactccggtgctgctcggcctgggcagcaatgtccagcgtgagccccatctg
catgccggcctcgatgcgctggccgagctgctggtgaacatgcgttgttcgccggtgttc
gaaagcctggcggtgggctacaagggcgacaacttctacaacctcgtggtcgccggcgat
accgagctgccgctgaccgaactggaccggcggctcaagttcatcgaggcggacaacggt
cgttacgcgccggatcgcaagggattgccactagatatcgacgtgctgctctatggcgag
ctggtcggcaatttccacggtttgctgctgccgcgtgcggagattctcaagaacgccttc
gtgctctggccgctggcgctgctggccccgaccgtacggcacccggccgcggacgccagc
tttgccgagctgtgggcgcaatcgaccatcgaccaacagctctggccggtgcccttccag
tggcgcggcgcggagctcacgcccccggagctggtccgcgcccacccgccgcgttgtgcc
tga

DBGET integrated database retrieval system