KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0636Help
Entry
PSTAB_0636        CDS       T01571                                 

Gene name
gabT
Definition
4-aminobutyrate aminotransferase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSTAB_0636 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSTAB_0636 (gabT)
   00310 Lysine degradation
    PSTAB_0636 (gabT)
Enzymes [BR:psz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSTAB_0636 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     PSTAB_0636 (gabT)
Amino acid related enzymes [BR:psz01007]
 Aminotransferase (transaminase)
  Class III
   PSTAB_0636 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
700593..701873
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFADHAKNSSVVDVEGREFIDFAGGIAVLNTGHLH
PKIVKAVEDQLHKLTHTCFQVLAYEPYVELCEKINARVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAFHGRTMMTLGLTGKVAPYSAGMGLMPGGIFRAQYPCAIHGVS
VDDSIASIERIFKNDAEPRDIAAIIVEPVQGEGGFNVAPKDFMARLRALCDEHGILLIAD
EVQTGAGRTGTFFAMEQMGVVADLTTFAKSVGGGFPIAGVCGKAEIMDAIAPGGLGGTYA
GNPLSCAAALAVMEIFEEEHLLDRCKAVAEKLTAGLKAIQAKHKEIGEVRGLGAMIAIEL
FEDGDLARPAAALTSQIVARAREKGLILLSCGTYYNVLRVLVPLTVEDELLERGLAILGE
CFDELT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgatgcaacgccgtgtcgccgctgttccccgtggcgtc
ggccagatccacccgatctttgccgaccacgcgaagaacagcagcgtggtggatgtggag
ggccgcgagttcatcgatttcgccggcggcatcgccgtgctgaataccggccacctgcac
ccgaagatcgtcaaggcggtggaagaccagctgcacaagctcacccacacctgcttccag
gtgttggcctacgagccgtacgtcgagctgtgcgagaagatcaacgcgcgggtaccgggt
gatttcgccaagaagactctgctggtcaccaccggctccgaggccgtggagaacgcggtg
aagatcgcccgcgccgccaccggccgtgccggcgtgattgccttcaccggcgcctttcac
ggccgcaccatgatgaccctcggtctgaccggcaaggtcgccccgtactccgccggcatg
ggcctgatgcccggcgggatcttccgtgcgcagtatccctgcgcgatccatggtgtcagc
gtcgatgactcgatcgcgagcatcgagcgcatcttcaagaacgacgccgagccgcgcgac
atcgccgcgatcatcgtcgaaccggtgcagggcgagggcggcttcaatgtcgcgccgaag
gatttcatggcccgcctgcgcgcgctctgcgacgagcacggcatcctgctgatcgccgac
gaggtgcagaccggcgccggacgcaccggcaccttcttcgccatggagcagatgggcgtg
gttgccgacctgaccaccttcgccaaatccgtcggtggtggtttcccgattgctggtgtc
tgtggcaaggccgagatcatggatgccatcgcgcccggcgggctgggcggcacctatgcc
ggcaacccgctgtcctgcgcggcggcgctggcggtcatggaaatcttcgaggaggagcat
ttgctcgaccgctgcaaggcggtggcggagaagctcaccgccggcctcaaggcgatccag
gccaagcacaaggagatcggcgaggtgcgcggcctcggcgcgatgatcgccatcgagctg
ttcgaggatggcgacctggcgcgaccggccgcggcgctgacgtcgcagatcgtcgcccgg
gcgcgggagaagggcttgatcctgctgtcctgcggtacctactacaacgtgctgcgcgtg
ctggtgccgctgaccgtcgaggacgagctgctcgagcgcggcctggccatcctcggcgag
tgtttcgacgagctgacctga

DBGET integrated database retrieval system