KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0773Help
Entry
PSTAB_0773        CDS       T01571                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00010  Glycolysis / Gluconeogenesis
psz00071  Fatty acid degradation
psz00350  Tyrosine metabolism
psz00625  Chloroalkane and chloroalkene degradation
psz00626  Naphthalene degradation
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_0773 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSTAB_0773 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSTAB_0773 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSTAB_0773 (adhA)
   00626 Naphthalene degradation
    PSTAB_0773 (adhA)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSTAB_0773 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N 2-Hacid_dh_C Urocanase Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEJ04054
UniProt: A0A0H3YWH9
Position
835213..836235
Genome map
AA seq 340 aa AA seqDB search
MTQTMKAAVVHAFGEPLRLEEVKVPMPGPGQILVKIAASGVCHTDLHAAEGDWPVKPSLP
FIPGHEGVGHVAAVGAGVTRVKEGDRVGVPWLYTACGCCEHCLTGWETLCEGQQNTGYSV
NGGYAEYVLADPNYVGILPKNVEFDEIAPILCAGVTVYKGLKVTGARPGQWVVISGIGGL
GHVAVQYAKAMGLHVVAVDVDDAKLELAKRLGAKLTINARTENPVEVVQRDIGGAHGVLV
TAVSNSAFGQAIGMARRHGTVALVGLPPGDFPTPIFDVVLKAISITGSIVGTRADLQEAL
DFAGEGLVKATIHTDSLDNINQIFDDMRAGRIEGRIVMKM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatgaaagcggcagtggttcacgcctttggcgagccgctgcgcctcgag
gaagtcaaggtgccgatgcccggccccggtcagatcctggtgaagatcgccgcctccggc
gtctgccacaccgacctgcacgctgccgagggcgactggccggtgaaaccgtccctgccg
ttcattcccggccatgaaggcgttggccacgtcgcggcggtgggtgccggcgtgacccgg
gtgaaggagggcgatcgcgtcggcgtgccctggctgtacaccgcctgcggctgctgcgag
cactgcctgaccggctgggaaaccctctgcgaaggccagcagaacaccggttactcggtc
aatggcggctacgccgaatacgtgctggccgacccaaactacgttggcatcctgccgaag
aacgtcgagttcgacgagatcgcgccgattctctgcgccggtgtcactgtctacaagggc
ctcaaggtcaccggtgcacgccccggccagtgggtggtgatctccggcatcggcggcctc
ggtcatgtcgcggtgcagtacgccaaggcgatggggctgcacgtggtggcggtggatgtg
gatgacgccaagctggagctggccaagcgtctgggtgccaagctgaccatcaacgcacgc
acggagaatcccgtggaggtggtccagcgcgatatcggcggcgcccacggcgtgctggtc
accgcggtgtccaacagcgccttcggccaggccatcggcatggcgcggcggcatggcacc
gtggcgctggtcgggctgccgccgggagacttcccgacgccgatcttcgacgtcgtgctc
aaggccatcagcatcaccggctcgatcgtcggcacccgcgccgatctgcaggaggcgctg
gatttcgccggcgagggcctggtcaaggcgaccatccacaccgacagcctggacaacatc
aaccagatcttcgacgacatgcgcgccgggcgcatcgaaggccgtatcgtgatgaagatg
tag

DBGET integrated database retrieval system