KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0848Help
Entry
PSTAB_0848        CDS       T01571                                 

Gene name
ccpR
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Brite
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PSTAB_0848 (ccpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(910715..911743)
Genome map
AA seq 342 aa AA seqDB search
MRPSLPLLLSSLLVTGAASADDLRERANAIFKPIPDKVTEVRGQKVSEDQAMLGHKLWFD
PRLSSSHVISCNTCHNLSIGGSDNVPTSIGHGWQKGPRNSPTVLNAVFNAAQFWDGRAKD
LQEQAKGPVQASVEMNSTPERVVATLKSIPEYAAEFKKAFPKDKDPVSFDNMAYALEAFE
VSLTTPNSPFDRFLKGEDKALDDKQKQGLALFMDAGCSACHNGVNLGGQGYFPFGVVKKP
GAEVLPAGDKGRFTVTNTASDEYVFRAAPLRNVALTPPYFHSGEVWELEQAVAIMGDSQL
GRQLNQDEVSAITAFLRSVTGDQPQVAYPVLPASTATTPKPE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccttctcttcccctattgcttagcagcctattggtcaccggcgccgcgagtgct
gacgatcttcgcgaacgcgccaatgccatcttcaagccgattccggacaaagtcaccgag
gtgcgtggccagaaggtcagcgaggatcaggccatgctcgggcacaagctgtggttcgac
ccgcgcctgtccagcagccatgtgatcagctgcaacacctgccacaacctgagcatcggc
ggcagcgacaacgtgccgacgtccatcggccatggctggcagaaaggcccgcgcaactcg
cccaccgtgctgaatgccgtgttcaacgccgcccagttctgggatggccgcgccaaggat
ctccaggaacaggccaagggcccggtccaggcgagcgtggaaatgaacagcacgcccgaa
cgcgtcgtcgccacgctcaagagcattccggagtacgccgccgagttcaagaaggccttc
ccgaaagacaaggacccggtcagcttcgacaacatggcctatgcgctggaagccttcgaa
gtcagcctcaccacgccgaactcaccgttcgaccgcttcctcaagggcgaggacaaggcc
ctggatgacaagcagaagcaaggcctcgcgctgttcatggacgcgggctgttccgcctgc
cacaacggcgtgaacctcggcggccagggctacttcccgttcggcgtcgtcaagaagccg
ggtgccgaagtgctgccggccggcgacaagggccgcttcacggtgaccaataccgccagc
gacgaatacgtcttccgcgccgcaccgctgcgcaacgtcgccctgacgccgccgtacttc
cacagcggcgaggtctgggaactggagcaggcggtggccatcatgggcgacagccagctg
ggccgtcagctcaatcaggacgaggtcagcgccatcaccgccttcctgcgcagcgtgacc
ggcgatcagcctcaggtagcctacccggtgctgcccgccagcaccgcgacgacgccgaag
cccgagtaa

DBGET integrated database retrieval system