KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0861Help
Entry
PSTAB_0861        CDS       T01571                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00330  Arginine and proline metabolism
psz00332  Carbapenem biosynthesis
psz01100  Metabolic pathways
psz01130  Biosynthesis of antibiotics
psz01230  Biosynthesis of amino acids
Module
psz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSTAB_0861 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PSTAB_0861 (proB)
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PSTAB_0861 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEJ04142
UniProt: F8GZ70
Position
922155..923273
Genome map
AA seq 372 aa AA seqDB search
MRDKVSGARRWVVKIGSALLTADGRGLDQAAMAVWVDQMVALRAAGVELVLVSSGAVAAG
MSRLGWASRPKAVHELQAAAAVGQMGLIRAWESSFARCDQQTAQILVTHDDLSDRKRYLN
ARSTLRTLIDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRHNPEANLISEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTVIVGG
RIEQVLSRLKAGERLGTLLAPECNRHAARKQWLAGHLQTRGTLTLDEGAVLALRQGNRSL
LPVGVRAVQGAFRRGEMVVCVGPQGAEVARGLVNYSAAEAQRILGRPSDEIEKLLGYVDE
PELIHRDNMILV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggtgagcggcgcgcggcgctgggtggtgaagattggcagtgcgctgctg
accgccgacggtcgagggctcgatcaggcggcgatggctgtctgggtcgaccagatggtg
gcgctgcgagcggcgggcgtcgagctggtgctggtctcgtccggtgcggtggccgccggc
atgagtcgtctcggctgggcttcgcgccccaaggcggtgcacgagcttcaggctgccgct
gcggtgggccagatggggttgattcgtgcctgggagtcgagctttgcgcgctgcgatcag
cagaccgcgcagattctggtcacccatgacgatctgtccgatcgcaagcgctacctcaat
gcgcgcagcacgttgcgcacgctcatcgatctcggcgtggtgccggtcatcaacgagaac
gacacggtggtcaccgacgagatccgcttcggtgacaacgataccctggccgcactggtt
gccaacctggtcgaggccgatctgctggtgatcctcaccgatcgcgatggcatgttcgat
gccgatccgcgccataaccccgaagccaatctgatcagcgaggcgcgtgccgacgacccg
gcgctggatgcggtcgcaggcggcaccggtggcgccctggggcgcggcggcatgcagacg
aagctccgggcggcgcgcctcgctgcgcgttccggtgcgcacacggtgatcgtcggtggg
cgcatcgagcaggtgctgtcgcgcctcaaggcgggcgagcggctgggtaccctgctggcg
cctgaatgcaatcggcatgcggcgcgcaagcaatggctggccgggcatctgcagacgcgt
ggcacgctgaccctggatgaaggggcggtgctggccttgcgtcagggcaaccgcagcctg
ctgccggtcggcgtgcgtgcggtgcagggcgcgttccgtcgtggcgagatggtggtctgc
gtcggtccgcagggcgccgaggtggcgcgtggtctggtgaattacagtgcagccgaggcg
cagcgcattctcgggcggccatccgacgagatcgaaaagctgctgggctatgtcgatgag
cccgagttgatccatcgcgacaacatgattctggtctga

DBGET integrated database retrieval system