KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0949Help
Entry
PSTAB_0949        CDS       T01571                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00340  Histidine metabolism
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PSTAB_0949 (hisD)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PSTAB_0949 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEJ04230
UniProt: F8GZW7
Position
1013240..1014547
Genome map
AA seq 435 aa AA seqDB search
MTAPSAIRRLNAADADFARHLDHLLSWESVSDDGVNERVLEIIKAVRERGDAAVVELTQR
FDALEVASMADLILPRARLEQALERITPAQREALEIAAERVRSYHERQKQDSWTYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVPEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPPVDKIVGPGNIYVATAKRHVFGKVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQSILVSPDAAFLDRVAESIARLLPTLER
ADIARTSIEGRGALIQVADMQQAIEVANRIAPEHLELSVAEPEQWLPQIRHAGAIFMGRY
TAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIINCSAEGASALGKVASVLARG
ESLTAHARSAEYRIK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccgccattcgccgactcaacgctgccgatgccgactttgcccgtcat
ctggaccatctgctgagctgggaaagtgtttctgatgacggtgtgaacgagcgggtcctc
gagatcatcaaggccgtgcgcgagcgtggtgatgcagcggttgtcgagctgacccagcgc
ttcgatgctctggaagtcgcctccatggcggacctgatcctgccgcgcgcgcgcctggag
caggcgctcgagcggatcacgccagcgcagcgcgaggccctggagatcgccgccgagcgc
gtacgcagctatcacgagcggcagaaacaggactcctggacctacaccgaggccgacggc
acggtgctcggtcagaaggtcaccccgctggatcgcgccggcctctacgtgccgggcggc
aaggcttcctacccatcttcagtgctgatgaatgccatcccggccaaggtcgccggcgtg
cccgaggtggtcatggtggtgcccacaccgcgcggcgaggtcaatgagctcgtgctggct
gctgcctgcatcgctggcgtagaccgcgtcttcaccattggcggtgcgcaggccgtcgca
gcattggcctatggcacggagagcgtaccgccggtggacaagatcgtcggcccgggcaat
atctacgtcgccacggccaagcgccacgtgttcggcaaggtcggcatcgacatgatcgcc
gggccgtcggaaattctcgtggtctgcgatggccagaccgatccggactggatcgccatg
gacctgttctcccaggccgaacacgacgaggatgcgcagtcgatcctggtcagcccggac
gccgctttcctcgatcgcgtcgccgagagcattgcccgtctgctgccgaccctggagcgc
gccgacatcgctcgcacctccatcgagggccgcggcgcgctgatccaggtggccgacatg
cagcaggccatcgaggtggccaaccgcatcgcccctgagcacctggaactttcggtcgcc
gagccggaacaatggctgccgcagattcgtcatgccggtgcgatcttcatgggacgctac
accgccgaggcgctgggtgattactgcgcagggcccaaccacgtgctgccgacctccggc
accgcgcgcttttcctcgccgctgggcgtttacgacttccagaagcgctcgtcgatcatc
aattgctcggccgagggcgcttcggcgctgggcaaggtggcatcggttctggcccgtggt
gaatcgctgaccgctcacgcgcgcagcgccgagtaccggatcaagtaa

DBGET integrated database retrieval system