KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0949Help
Entry
PSTAB_0949        CDS       T01571                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAB_0949 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    PSTAB_0949 (hisD)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PSTAB_0949 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013240..1014547
Genome map
AA seq 435 aa AA seqDB search
MTAPSAIRRLNAADADFARHLDHLLSWESVSDDGVNERVLEIIKAVRERGDAAVVELTQR
FDALEVASMADLILPRARLEQALERITPAQREALEIAAERVRSYHERQKQDSWTYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVPEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPPVDKIVGPGNIYVATAKRHVFGKVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQSILVSPDAAFLDRVAESIARLLPTLER
ADIARTSIEGRGALIQVADMQQAIEVANRIAPEHLELSVAEPEQWLPQIRHAGAIFMGRY
TAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIINCSAEGASALGKVASVLARG
ESLTAHARSAEYRIK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccgccattcgccgactcaacgctgccgatgccgactttgcccgtcat
ctggaccatctgctgagctgggaaagtgtttctgatgacggtgtgaacgagcgggtcctc
gagatcatcaaggccgtgcgcgagcgtggtgatgcagcggttgtcgagctgacccagcgc
ttcgatgctctggaagtcgcctccatggcggacctgatcctgccgcgcgcgcgcctggag
caggcgctcgagcggatcacgccagcgcagcgcgaggccctggagatcgccgccgagcgc
gtacgcagctatcacgagcggcagaaacaggactcctggacctacaccgaggccgacggc
acggtgctcggtcagaaggtcaccccgctggatcgcgccggcctctacgtgccgggcggc
aaggcttcctacccatcttcagtgctgatgaatgccatcccggccaaggtcgccggcgtg
cccgaggtggtcatggtggtgcccacaccgcgcggcgaggtcaatgagctcgtgctggct
gctgcctgcatcgctggcgtagaccgcgtcttcaccattggcggtgcgcaggccgtcgca
gcattggcctatggcacggagagcgtaccgccggtggacaagatcgtcggcccgggcaat
atctacgtcgccacggccaagcgccacgtgttcggcaaggtcggcatcgacatgatcgcc
gggccgtcggaaattctcgtggtctgcgatggccagaccgatccggactggatcgccatg
gacctgttctcccaggccgaacacgacgaggatgcgcagtcgatcctggtcagcccggac
gccgctttcctcgatcgcgtcgccgagagcattgcccgtctgctgccgaccctggagcgc
gccgacatcgctcgcacctccatcgagggccgcggcgcgctgatccaggtggccgacatg
cagcaggccatcgaggtggccaaccgcatcgcccctgagcacctggaactttcggtcgcc
gagccggaacaatggctgccgcagattcgtcatgccggtgcgatcttcatgggacgctac
accgccgaggcgctgggtgattactgcgcagggcccaaccacgtgctgccgacctccggc
accgcgcgcttttcctcgccgctgggcgtttacgacttccagaagcgctcgtcgatcatc
aattgctcggccgagggcgcttcggcgctgggcaaggtggcatcggttctggcccgtggt
gaatcgctgaccgctcacgcgcgcagcgccgagtaccggatcaagtaa

DBGET integrated database retrieval system