KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0980Help
Entry
PSTAB_0980        CDS       T01571                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psz00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:psz00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1045730..1047193
Genome map
AA seq 487 aa AA seqDB search
MPMPLNHLLPHAGSDVLIRELTLDSRKVRGGDLFLAVPGLQHDGRDHVQDAIARGAAAVA
YESEGLDQALTGAAVMVPVHHLAGQLSAIAGRFYGEPSRNLRLVGVTGTNGKTSVSQLIA
QALDRLGEPCGIIGTLGTGFYGQLEMGRHTTPDAIGVQATLAQLKQEGARAVAMEVSSHG
LDQGRVAALEFDVAVFTNLSRDHLDYHGTMEAYGAAKARLFGVPGLSCRVINLDDGFGRA
LAGEERESRLISYSLEDASAYLYCPEAQLDDDGIHARLITPQGERSLRSPLLGRFNVSNV
LAAVGALLGMDYPLDEILAVLPELEGPAGRMQRLGGGDRPLVVVDYAHTPDALEKVLTAL
RPHARGRLLCLFGCGGDRDTGKRPLMAEVAERLADGVVVTDDNPRNEAPERILDDVRSGF
VNPEAVTFVQGRAQAIARLIAAANASDVVVLAGKGHEDYQDIRGERLPFSDIEEACTALS
TWEKPDA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgccattgaatcacctgctgccacacgccggcagtgacgtcctgatccgcgag
ctgacgctcgacagccgcaaggttcgtggcggcgacctgttcctggcggtgccggggctg
cagcatgacgggcgcgatcatgtacaggacgccattgcccgcggcgccgctgcggtcgct
tacgaatccgaagggctggatcaggcgctgaccggtgccgcggtgatggtgccggtgcat
cacctggccggtcagctctcggccatagccgggcgcttctacggagagcccagccgcaac
ctgcgtctggtcggtgtcaccggaaccaacggcaagaccagcgtcagccagctgatcgcc
caggccctcgaccgtctcggcgaaccctgcgggatcatcggcaccctgggcaccggtttc
tacggtcagctggaaatggggcggcataccacgccggatgcgatcggcgttcaggcgacc
cttgctcagctgaagcaggaaggcgcgcgcgccgtggcgatggaggtgtcgtcccatggc
ctcgatcagggccgcgtcgccgcgctggagttcgacgtcgctgtctttaccaacctgtcg
cgcgaccatctcgattaccacggcaccatggaagcctacggcgctgccaaggctcggctg
ttcggcgtgcctggtctgagctgtcgggtgatcaatctcgacgatggcttcggccgtgcg
ctagccggtgaggagcgcgaatcgcggctgatcagctacagcctggaagacgcctctgcc
tacctgtactgccccgaggcgcagctcgacgatgacggcattcatgcgcggctgatcacc
ccgcagggtgagcgctcgctgcgcagcccgctgctgggccgcttcaacgtcagcaacgtg
ctcgccgccgttggcgccttgctcggtatggactacccgctggacgagatcctcgccgtg
ctgccggagcttgaaggcccggccggccgcatgcagcgtctgggcggcggcgaccggcca
ctggtggtggtcgattacgcccatacccccgacgctctggaaaaggtgcttactgcacta
cgtccgcacgcacgtggtcgcttgctctgcctgttcggctgcggtggtgaccgtgacacc
ggcaagcgcccactcatggccgaggtcgccgagcggctggccgatggggttgtggttacc
gatgacaacccgcgcaacgaggcgccggaacgcattctcgacgatgtccgcagcggcttc
gtcaatccggaagcggtgacctttgtgcagggtcgcgcccaggcgattgcccggctcatc
gcggccgccaatgccagcgatgtggtagtgctcgctggcaagggccacgaggactatcag
gacattcgcggcgagcggctgccgttctccgatatcgaggaagcctgtaccgcactgtcc
acctgggagaagcccgatgcttga

DBGET integrated database retrieval system