KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1040Help
Entry
PSTAB_1040        CDS       T01571                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psz00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:psz00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1106922..1107626)
Genome map
AA seq 234 aa AA seqDB search
MHQAPILITGASQRIGLHCAERLLDDGYPVIISYRRERDSVARLRARGAQVVQADFSDEA
GIHAFITAIRQLTGSLRAIVHNASQWRADTPGQEADAFRQLFQIHMLAPYLINLRCADLL
RYGGPADIVHIGDDVTRKGSKKHIAYAASKAGLDSLTLSFAASLAPQIKVNGIAPALIQF
NPDDDEDYRRKALAKSALGIEPGAEVIYQSLRYLLDNPYVTGTTLTVNGGRHLI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggccccgattctcatcaccggagccagccagcggatcgggttgcattgcgcc
gaacgcctgctggatgacggttacccggtcatcatcagctaccgtcgcgagcgcgacagc
gtagcgcggctgcgtgcccgcggagcgcaggtggtgcaggcggacttcagcgatgaagcc
ggcattcatgccttcatcactgccatccggcaactgaccggcagcctgcgggcgatcgtg
cacaacgcctcgcaatggcgcgccgatacgcccgggcaggaagccgacgccttccgccag
ctgtttcagatccacatgctcgcgccctacctgatcaacctgcgctgtgccgatttgctg
cgctacggcggcccggcggatatcgtgcacatcggcgacgatgtcacccgcaagggcagc
aagaagcacatcgcctacgccgcgagcaaggccggcctggacagcctgacgctttccttc
gccgccagcctggccccgcagatcaaggtcaacggcattgcgccggcgctgatccagttc
aacccggacgacgacgaggactatcgccgcaaggcattggccaagtcggcgctgggtatc
gagcccggcgccgaagtgatctaccagagcctgcgctatctgctcgacaatccctacgtc
accggcaccacactgaccgtcaacggcggtcgccatctgatctga

DBGET integrated database retrieval system