KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1064Help
Entry
PSTAB_1064        CDS       T01571                                 

Gene name
sbcB
Definition
exonuclease I
Orthology
K01141  
exodeoxyribonuclease I [EC:3.1.11.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:psz03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1129220..1130653
Genome map
AA seq 477 aa AA seqDB search
MTPSIFWYDFETTGISPSRDRPLQVAGIRTNEALEEIGEPLNIYCRPGDDILPHPAACLV
TGITPAVLQQKGMCEAQFVHHLHRELSTPGTCGAGYNSLRFDDEVTRYSLYRNFYDPYAR
EWQGGNSRWDLIDLVRTAYALRPEGIGWPEDDGRVTLKLERLSAANGLEHLNAHDALSDV
RATIGLARLIRERQPRLYEYLFNLRRKHAVLEQVTLLEPLVHVSGRFSAARHFLSVVLPL
AWHPRNRNALIVCDLQAEVRPLWLESAETLRQRLYTRRDELAEGELPVPLKLVHINKCPV
LAPLKVLREADIQRLELDLPACHERADALREQRHVWSPKLDEVYREEGFIGVDDPEQQLY
DGFLGERDRRLCDRIREMAPAELARQQCHFDDVRLEELLFRYRARNFPEALSAEERVRWQ
RFCQQRLSGEIAGAPNTLAQFEADIQQFMLTATPAQQQLLQQWREYGRALGERYGCN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgactccaagcatcttctggtacgacttcgaaaccacaggcatatcgcccagccgcgac
cgccccttgcaggttgccggtatccgcaccaacgaggcgctcgaggaaatcggcgagccg
ctgaacatctactgtcgacccggcgacgacatccttccccatcccgccgcgtgcctggtc
acgggaatcacgcctgcagttctgcagcagaaggggatgtgcgaggcccagttcgttcat
catctgcatcgggaattgtcgactcccggaacctgcggcgccggctacaacagcctgcgt
ttcgacgacgaagtgacccgctacagcctgtaccgcaatttctacgatccgtatgcacgc
gaatggcagggcggcaacagccgttgggatctgatcgatctggtgcgtaccgcctatgcg
ctgcgcccggaaggaattggctggccggaagacgacgggcgggtgacgctcaagctcgag
cgtttgagtgccgccaatgggctggaacatctgaacgcccacgacgcgctgtccgatgtg
cgcgccaccattggcctcgccaggctcattcgtgagcggcagccgcgtctgtacgaatat
ctcttcaatctgcgtcgcaaacatgcggtgctcgagcaggtcaccctgctggagccgctg
gtgcacgtgtccggacgcttctcggctgcccggcatttcctctccgtggtgctgccgctg
gcctggcatccgcgcaaccgcaatgcgctgatcgtttgcgatctgcaagccgaggtgcgg
ccgttatggctggaaagcgcggaaacgctgcgacagcggctctacacgcgtcgcgacgag
ctggccgagggcgaattaccggtcccgctgaagctcgtgcacatcaacaagtgcccggtc
ctggcgccgctcaaggtcttgcgcgaggcggatatccagcgtctggagctggacttgcct
gcgtgccacgaacgtgctgacgcgctacgcgaacagcgccacgtgtggagcccaaagctg
gacgaggtgtaccgcgaagaggggttcatcggtgtggacgatccggaacagcaactctat
gacggctttctgggcgagcgcgatcggcggctgtgcgatcggattcgcgagatggcgccg
gcagagctcgctcggcaacagtgccacttcgatgatgtacggttagaggaattgctgttc
cgttatcgcgcgcgcaactttccggaagcgttatcggctgaagagcgggtgaggtggcaa
cggttctgccaacagcgccttagcggcgagatagccggcgcgcccaatacccttgcgcag
ttcgaggcggatatacaacagttcatgctcactgccaccccggcgcagcagcagctattg
cagcagtggcgtgaatacgggcgcgccttgggtgagcgttacgggtgcaactag

DBGET integrated database retrieval system