KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1064Help
Entry
PSTAB_1064        CDS       T01571                                 

Gene name
sbcB
Definition
exonuclease I
Orthology
K01141  
exodeoxyribonuclease I [EC:3.1.11.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:psz00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    PSTAB_1064 (sbcB)
Enzymes [BR:psz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.1  exodeoxyribonuclease I
     PSTAB_1064 (sbcB)
DNA repair and recombination proteins [BR:psz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      PSTAB_1064 (sbcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1129220..1130653
Genome map
AA seq 477 aa AA seqDB search
MTPSIFWYDFETTGISPSRDRPLQVAGIRTNEALEEIGEPLNIYCRPGDDILPHPAACLV
TGITPAVLQQKGMCEAQFVHHLHRELSTPGTCGAGYNSLRFDDEVTRYSLYRNFYDPYAR
EWQGGNSRWDLIDLVRTAYALRPEGIGWPEDDGRVTLKLERLSAANGLEHLNAHDALSDV
RATIGLARLIRERQPRLYEYLFNLRRKHAVLEQVTLLEPLVHVSGRFSAARHFLSVVLPL
AWHPRNRNALIVCDLQAEVRPLWLESAETLRQRLYTRRDELAEGELPVPLKLVHINKCPV
LAPLKVLREADIQRLELDLPACHERADALREQRHVWSPKLDEVYREEGFIGVDDPEQQLY
DGFLGERDRRLCDRIREMAPAELARQQCHFDDVRLEELLFRYRARNFPEALSAEERVRWQ
RFCQQRLSGEIAGAPNTLAQFEADIQQFMLTATPAQQQLLQQWREYGRALGERYGCN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgactccaagcatcttctggtacgacttcgaaaccacaggcatatcgcccagccgcgac
cgccccttgcaggttgccggtatccgcaccaacgaggcgctcgaggaaatcggcgagccg
ctgaacatctactgtcgacccggcgacgacatccttccccatcccgccgcgtgcctggtc
acgggaatcacgcctgcagttctgcagcagaaggggatgtgcgaggcccagttcgttcat
catctgcatcgggaattgtcgactcccggaacctgcggcgccggctacaacagcctgcgt
ttcgacgacgaagtgacccgctacagcctgtaccgcaatttctacgatccgtatgcacgc
gaatggcagggcggcaacagccgttgggatctgatcgatctggtgcgtaccgcctatgcg
ctgcgcccggaaggaattggctggccggaagacgacgggcgggtgacgctcaagctcgag
cgtttgagtgccgccaatgggctggaacatctgaacgcccacgacgcgctgtccgatgtg
cgcgccaccattggcctcgccaggctcattcgtgagcggcagccgcgtctgtacgaatat
ctcttcaatctgcgtcgcaaacatgcggtgctcgagcaggtcaccctgctggagccgctg
gtgcacgtgtccggacgcttctcggctgcccggcatttcctctccgtggtgctgccgctg
gcctggcatccgcgcaaccgcaatgcgctgatcgtttgcgatctgcaagccgaggtgcgg
ccgttatggctggaaagcgcggaaacgctgcgacagcggctctacacgcgtcgcgacgag
ctggccgagggcgaattaccggtcccgctgaagctcgtgcacatcaacaagtgcccggtc
ctggcgccgctcaaggtcttgcgcgaggcggatatccagcgtctggagctggacttgcct
gcgtgccacgaacgtgctgacgcgctacgcgaacagcgccacgtgtggagcccaaagctg
gacgaggtgtaccgcgaagaggggttcatcggtgtggacgatccggaacagcaactctat
gacggctttctgggcgagcgcgatcggcggctgtgcgatcggattcgcgagatggcgccg
gcagagctcgctcggcaacagtgccacttcgatgatgtacggttagaggaattgctgttc
cgttatcgcgcgcgcaactttccggaagcgttatcggctgaagagcgggtgaggtggcaa
cggttctgccaacagcgccttagcggcgagatagccggcgcgcccaatacccttgcgcag
ttcgaggcggatatacaacagttcatgctcactgccaccccggcgcagcagcagctattg
cagcagtggcgtgaatacgggcgcgccttgggtgagcgttacgggtgcaactag

DBGET integrated database retrieval system