KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1103Help
Entry
PSTAB_1103        CDS       T01571                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Brite
Enzymes [BR:psz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PSTAB_1103 (dsbC)
Secretion system [BR:psz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSTAB_1103 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164355..1165083
Genome map
AA seq 242 aa AA seqDB search
MGVIRMFAAATVGLVSTVAMAADPDQAIRQSLQKIQPDMPIEAVAESPMPGVYQVQLEGG
RQLYASADGQFVIQGYLYQFKDGQAVNLTEQAQSRSVAKQINAIPASEMVVFAPKAPKTH
ITVFTDTDCGYCQKLHSEVPQLNRLGVEVRYVAFPRQGMGSHGANTLTSVWCAKDRQDAM
NKAKAREDLPAASCDTPIAKQYQLGQMIGVQGTPAIILANGQMIPGYQPAAQLAEVALAA
AK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgattcgtatgttcgctgccgccacagttggtctggtcagcaccgttgcaatg
gccgccgatccggatcaggcaatacgtcaatcgctgcagaaaattcagcccgacatgccg
atcgaggcggtagccgagagcccgatgccgggggtgtatcaggttcagctggaaggcggg
cggcagctgtatgccagtgctgacggtcagtttgtcattcagggttatctctaccagttc
aaggatgggcaggcggtcaacctaaccgagcaggcgcagagccgatcggtggccaagcag
atcaacgccattccggcgagtgagatggtggtgttcgcacccaaggcgccgaaaacccat
atcaccgtgttcaccgacaccgattgtggctattgccagaagctgcacagcgaagtgcct
cagctcaaccgtctcggtgtggaggtgcgctatgtggcgttcccgcgccaggggatgggc
agccacggtgccaataccctgaccagtgtgtggtgcgccaaggaccgtcaggatgccatg
aacaaggccaaggctcgtgaagatctgccggcagccagttgcgataccccgatcgccaag
caataccagttggggcagatgatcggtgtgcagggtacgccggccatcattctcgccaac
ggtcaaatgatccccggctaccagccagcggcgcagcttgcagaggtggcgctcgctgcg
gccaagtaa

DBGET integrated database retrieval system