KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1106Help
Entry
PSTAB_1106        CDS       T01571                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAB_1106 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAB_1106 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSTAB_1106 (thrC)
Enzymes [BR:psz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSTAB_1106 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1167153..1168562
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTVEEIASWAGLPYHELAFRVMR
PFVAGSIPDADFKKILEETYGVFAHGAIAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLAKRGERVVIMGATSGDTGSAAIEGCRRCENVDIFILHPHQRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNHYDKDTL
HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVADLLDGFRASGRLSVEEDRWAEARRLFDS
LAVDDEQTCATIARVFKETGEVLDPHTAIGVHAARECRRSLSIPMVTLGTAHPVKFPDAV
EKAGIGQALALPAHLADLFERSERCTVLPNELKAVQAFVGQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatcagcacccgcggccaggcaccggccctgaatttcgaagatgtgctgctg
gccggtctggccagcgacggcggcctctacgtgccggagaacctgccgcgcttcaccgta
gaggaaatcgcttcctgggccggcctgccgtatcacgaactggcgttccgggtcatgcga
ccattcgttgccggcagcattccggatgccgacttcaagaaaatcctggaagagacctat
ggcgttttcgcccatggcgccattgccccgctgcgccagctgaacggcaacgagtgggta
ctcgagctgttccacggtccgaccttggccttcaaggatttcgccctgcagctgctcggc
cgtctgctcgactacgtgctggccaagcgtggcgagcgcgtggtgatcatgggagccacc
tccggtgacaccggttcggcagccatcgaaggctgccgccgttgcgagaacgtcgatatc
ttcatcttgcacccgcatcagcgcgtgtcggaagtgcagcgccggcagatgaccactatc
ctcggcgacaacatccataacatcgccatcgaaggcaatttcgatgactgccaggagatg
gtcaaggccagcttcgccgaccaggggttcctcaagggcacccgcctggtggcagtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgccgcactgcag
ctgggcggcccggcgcgttcggtcgccttctcggtcccgaccggcaatttcggtgacatc
ttcgccggctacctggcgcgcaacatggggctgccgatcaatcagctgatcgttgccacc
aaccgcaacgacatcctgcaccgtttcatgtccggcaatcactacgacaaggacacgctg
catccctcgctgtcgccgtccatggacatcatggtgtcctccaacttcgaacgcctgctg
ttcgacctgcacggtcgcaacggcaaggccgtagccgatctgctggatggcttccgcgcc
agcggcagactttcggtggaagaggatcgctgggccgaagcgcgtcgactcttcgattcg
ctggcggtggacgacgagcagacttgcgcgaccatcgcccgggtgttcaaggagaccggt
gaggtgctcgatccgcataccgccatcggcgtgcacgccgctcgtgaatgccgtcgtagc
ctgagcatcccgatggtcacgctgggcaccgcgcatccggtgaaattcccggatgcggtg
gagaaggccggtatcggtcaggcgctggcgctgccggcgcaccttgccgacctgttcgag
cgcagcgagcggtgcacggtgttgccaaacgagctcaaggcggtgcaggccttcgtcggc
cagcacggcaatcgcggcaagccgctctaa

DBGET integrated database retrieval system