KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1391Help
Entry
PSTAB_1391        CDS       T01571                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSTAB_1391
Enzymes [BR:psz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PSTAB_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1449875..1451278
Genome map
AA seq 467 aa AA seqDB search
MSTNLFTGARKALVASIAMAALMGGVTVATVPYAAAATTVAAASVSTKVNAFTNTDWLNG
VWRTGAGFSIPATAANQAAFKAGASVRLADGQVRTISRAQVVGSNMSVFLDGAKLDGNKV
GAPQSVATVAAAPAPSPAPSAPSTTNGKPLLVGVNLSGAGFGPSVVPGTHGTNYTYPAES
YYKKYADLGMPLVRLPFLWERIQPKLNTPLNATELARLKQSLDFAQKHNVKVILDLHNYY
RYFNKLIGSNEVPISSFAAVWKQIAQEVVNHPAVEGYGLMNEPHSTNGLWPQAALAAAQA
IRTVDSKRWIYVAGDRWSSAFHWPHYNTQLISNPWMRDPKNNLVYEAHMYIDKDFSGNYF
DKNEKFDPMIGVNRVKPFVDWLKQNKLRGYIGEHGIPDFSPSALVATDNLLSYLRQNCIP
STYWAAGPWWGEYALSLDVTSGKHRPQLPILQKHAKTAHSCTSIGPL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaacctgtttaccggtgcccgtaaggcactcgtcgcttccatcgccatggct
gctctcatgggtggcgtaaccgtagcaactgttccttacgctgctgcagctaccactgtc
gctgcagcctccgtttccaccaaggtcaacgcctttaccaataccgactggcttaatggt
gtctggcgcactggcgcaggcttctccattccggccacggctgccaaccaggcggctttc
aaggcgggcgcctcggttcgcctggcggacggccaagtgcgcaccatcagccgcgcgcag
gtcgtcggcagcaacatgagtgtgttccttgatggcgccaagctcgatggcaacaaggtg
ggtgcaccgcagtcggtcgcaaccgtggctgccgcaccggccccgagcccagcgccgtca
gcgccgagcaccaccaatggcaagccgctgctggttggcgtcaacctgtccggtgcaggc
ttcggcccgtcggtggttcccggtacacacggcaccaactacacctacccggccgagtcg
tactacaagaagtacgccgacctcggcatgccgctggtacgcctgccgttcctctgggag
cgtatccagcccaagctgaacacgccgctgaatgccacagaacttgcgcgcctgaagcag
tcgctggatttcgcgcagaagcacaacgtcaaggtgatcctcgacctgcacaactactac
cgctatttcaacaagctgatcggctcgaacgaagtacccatcagctcattcgcggcggtg
tggaagcagattgcgcaggaagtggtcaaccacccggcggtggaaggttacgggctgatg
aacgagccacattcgaccaatgggctctggccacaggccgccctggctgctgctcaggcg
atccgcaccgtggattccaagcgctggatctacgtggccggtgaccgctggtccagtgcc
ttccactggccgcactacaacactcagctgatcagcaacccgtggatgcgcgatccgaag
aacaacctggtgtacgaagcacacatgtacatcgacaaggatttctccggtaactacttc
gacaagaacgaaaagttcgacccgatgatcggtgtcaatcgcgtcaagcctttcgtcgac
tggctgaagcagaacaagctgcgtggctacatcggtgagcacggtattccggacttctcg
ccgtccgccctggtggccactgacaacctgctgtcttacctgcgtcagaactgcatcccc
agcacttactgggcagcaggtccctggtggggcgagtacgcactgtcgctggacgtgacc
agtggcaagcaccgcccgcagctgccgattctgcagaagcacgccaagaccgcgcacagc
tgcaccagcatcggtccgctgtaa

DBGET integrated database retrieval system