KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1447Help
Entry
PSTAB_1447        CDS       T01571                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSTAB_1447
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PSTAB_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1507054..1508232
Genome map
AA seq 392 aa AA seqDB search
MQITILGATGSIGLSTLDVVARHPDRYDVFALTGFSRLAELRALCLKHRPRYAVVGDQAQ
ARILQDQLHADGVSTRVLDGEGGLSEVAAHPEVDVVMAAIVGAAGLKPTLAAVQSGKRVL
LANKEALVMSGALFMQALRDSGAVLLPIDSEHNAIFQCLPTDYSQGLGTVGVRRILLTAS
GGPFREMAPDLLSDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDARPHQV
EVVIHPQSVIHSMVDYVDGSVLAQLGNPDMRTPIAHALAWPERIESGVSALDLLRVGRLD
FQAPDDRRFPCLRLARTAAEVGGTAPAMLNAANEVAVDAFLNRRIRFTEIASIIDDVLNH
EASVPTVCLEDVLAADRRARDVAGQWLYRNGR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgcagatcaccatattgggcgcgaccggctcgatcggcctgagcacgctcgatgtcgtc
gcccgccatccggatcgctacgatgttttcgccctgaccggcttcagtcggcttgccgag
ctgcgtgcgctctgcctcaagcaccgaccacgctatgcggtcgttggtgatcaggcgcag
gcgcggatactgcaggatcagctgcatgccgatggcgtcagcactcgcgtgctggacggc
gaaggtgggttgagcgaagtggcagcgcacccggaggtggacgtggtaatggccgccatc
gtcggggcggcagggttgaagcctacgctcgcggcggtgcagtccggcaagcgggtgctg
ctggccaacaaggaggcgctggtcatgtccggtgccttgttcatgcaggcgttgcgtgac
agcggtgccgttctgctgccgatcgatagcgagcacaacgcgatttttcagtgcctgccg
acggactattcgcaaggccttgggaccgtcggtgtgcgcaggatcctgctcaccgcttcg
ggtgggccgttccgagaaatggcgcccgaccttctgagcgatgtgactcccgagcaggcg
tgcgctcatcccaattggtccatggggcgaaagatctcggtggattcggcgagcatgatg
aacaaggggctcgaattgatcgaggcctgctggctgttcgatgcacgcccgcatcaggtc
gaggtggtcatccatccgcagagcgtcattcattccatggtggactacgtggatggctcc
gtactggcgcagctgggcaatccggacatgcgcacgccgatcgcgcatgcgctggcctgg
ccggagcggattgagtcgggcgtatcggcgcttgatctgctgcgggtcgggcgtctggac
ttccaggctcccgatgatcggcgtttcccttgtctgcgactcgcccggacggcggcggag
gtcggtgggaccgcgccggcaatgctcaatgcggcgaacgaggtggccgtcgacgcgttt
ctcaatcgtcgcatccgtttcaccgagatcgcgagtatcatcgacgacgtgttgaatcat
gaggcgtcggttcccaccgtttgcctcgaagatgtgttggcggctgacaggcgcgcccgg
gatgtcgccgggcagtggctgtaccgcaacgggcgatag

DBGET integrated database retrieval system