KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1475Help
Entry
PSTAB_1475        CDS       T01571                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1536899..1537507
Genome map
AA seq 202 aa AA seqDB search
MIQRLYEEGLSNAHVLEVIRRTPRHLFVDEALAHRAYEDTALPIGHNQTISQPFMVARMS
ELLLADGPLDKVLEIGTGSGYQTAVLAQLVERVFSVERIQALQDRAKERLVELKLRNVVF
RWGDGWEGWPALAPYNGIIVTAAAADVPQALLDQLAPGGRLVIPVGAGEVQQLMLIIREE
NGFSRHLLDTVRFVPLLNGPVI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgattcagcgactctacgaagaaggcctgtccaacgcccatgtgctcgaagtgatccgc
cgtacccctcgtcatctgttcgtcgacgaggcactggcgcatcgcgcctacgaggacacg
gcgctgcccatcggccacaaccagaccatttcgcagccgttcatggttgcgcgcatgagc
gaactgttgctggctgacggcccgctggacaaggtgctggagatcgggaccggctcgggc
tatcagaccgccgtgctggcgcagctggtcgagcgggtgttctcggtcgagcgcatccag
gcgctgcaggatcgtgccaaggagcgcctggtcgaactcaagctgcgcaatgtggtcttt
cgctggggcgatggttgggagggctggcctgcactggcgccttacaacggcatcatcgtc
accgcggcggcagccgatgtgccgcaggccttgctcgatcagctggcgcccggtgggcgc
ctggtgattccggtgggggccggcgaggtccagcaactcatgctgatcattcgagaggaa
aacggcttttcccgccatcttctggataccgtacgtttcgtgccgctgctcaatggaccc
gtgatttga

DBGET integrated database retrieval system