KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1620Help
Entry
PSTAB_1620        CDS       T01571                                 

Gene name
faoA
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSTAB_1620 (faoA)
   01212 Fatty acid metabolism
    PSTAB_1620 (faoA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSTAB_1620 (faoA)
   00650 Butanoate metabolism
    PSTAB_1620 (faoA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSTAB_1620 (faoA)
   01040 Biosynthesis of unsaturated fatty acids
    PSTAB_1620 (faoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTAB_1620 (faoA)
   00310 Lysine degradation
    PSTAB_1620 (faoA)
   00380 Tryptophan metabolism
    PSTAB_1620 (faoA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSTAB_1620 (faoA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSTAB_1620 (faoA)
   00281 Geraniol degradation
    PSTAB_1620 (faoA)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PSTAB_1620 (faoA)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSTAB_1620 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSTAB_1620 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSTAB_1620 (faoA)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PSTAB_1620 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697253..1699400
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNDLRQAVDAIKADASVKGVIVTS
GKDVFIVGADITEFVDNFKLPDEELVAGNLEANKIFSDFEDLGVPTVVAINGIALGGGFE
MCMAADYRVMSTTAKVGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDAL
KVHAVDAVVAPEKLQEAALDLVKRAISGELDYKAKRQPKLDKLKLNAIEQMMAFETSKAF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSVAESLVGLFLSDQEL
KKKAKAYDKQARDVKLAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEGIQMGLDEASKL
LGKRVEKGRLTADKMAQALNAIRPTMSYGDFGTVDIVVEAVVENPKVKHAVLAEVEGHVR
EDAIIASNTSTISISYLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTSETAIATTVA
YAKKMGKSPVVVNDCPGFLVNRVLFPYFGGFARAIAHGVDFVRADKVMEKFGWPMGPAYL
MDVVGMDTGHHGRDVMAEGFPDRMKDDTRTAVDVMYDANRLGQKNGKGFYAYEMDKKGKP
KKVVDPQAYELLKPIVAETRELSDEDIINYMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVAMADKYADLGPLYHPTAKLREMAANGQRFYG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgagagcggcatcgtcgaattg
aatttcgacctcaagggtgagtccgtcaataaattcaatcgcctcactctcaacgatctg
cgccaggctgtcgatgccatcaaggccgacgcttcggtcaagggcgtgatcgtcaccagc
ggcaaggatgtgttcatcgtcggtgccgacatcaccgagttcgtcgacaacttcaagttg
cccgatgaagagctggttgccggcaacctcgaagcgaacaagatcttcagcgatttcgaa
gacctgggcgtacccaccgtggtcgccatcaacggcatcgccctgggtggcggtttcgag
atgtgcatggctgccgactatcgcgtcatgtccaccaccgccaaggtcggcctgccggaa
gtcaagctgggcatctacccgggcttcggcggtactgtgcgtctgccgcgcctgatcggt
gtggacaacgccgtcgagtggatcgcctccggcaaggaaaaccgtgccgaagacgccctc
aaggtgcacgcggtcgatgccgtcgtcgctccggagaaactgcaggaagctgccctggac
ctggtcaagcgcgccatctccggcgagctggactacaaggccaagcgtcagccgaagctg
gacaagctcaagctcaacgccatcgagcagatgatggccttcgaaaccagcaaggccttc
gtggctggccaggccggcccgaactacccggccccggtcgaagccatcaagaccattcag
aaagccgccaacttcggccgtgacaaggcgctagaagtcgaggctgctggcttcgtcaag
ctggccaagacctcggttgccgaaagcctggtcggcctgttcctcagcgatcaggaactg
aagaagaaggccaaggcctacgacaagcaggcccgcgacgtgaaactggctgccgtactc
ggcgccggcatcatgggtggcggcatcgcctaccagtcggccgtcaagggcacgccgatc
ctgatgaaggatatccgcgaagagggtatccagatgggcctggacgaagcctccaagctg
ctcggcaagcgtgtcgagaaaggccgtctgaccgctgacaagatggcgcaggcgctcaac
gcgatccgcccgaccatgtcctatggcgatttcggcaccgtcgacatcgtcgtcgaagcc
gtggtcgagaacccgaaggtcaagcacgccgtgctggccgaggtggaagggcacgtacgc
gaggacgcgatcatcgcctccaacacctccaccatctccatcagctacctggcccaggcg
ctcaagcgtccggaaaacttctgcggcatgcacttcttcaacccggtgcacatgatgccg
ctggttgaggtgatccgcggcgagaagaccagcgaaaccgccatcgccaccaccgtcgcc
tacgccaagaaaatgggcaagagtccggtcgtggtcaacgactgcccgggcttcctcgtc
aaccgcgtgctgttcccgtacttcggcggcttcgctcgcgccatcgcccacggtgtcgac
ttcgttcgtgccgacaaggtgatggagaagttcggttggcccatgggcccggcctacctg
atggacgtcgtcggcatggacaccggccaccacggccgtgacgtgatggccgaaggcttc
ccggatcgcatgaaggacgatacccgcaccgccgtcgacgtcatgtacgacgccaaccgc
ctcggtcagaagaacggcaagggcttctatgcctacgagatggacaagaagggcaagccg
aagaaggtcgtcgacccgcaggcctacgagctgctcaagccgatcgtcgccgagacgcgc
gagctgtccgacgaggacatcatcaactacatgatgatcccgctgtgcctggaaaccgtg
cgctgcctggaagacggcatcgtcgagaccgctgccgaagccgacatgggcctgatctat
ggcattggcttcccacccttccgtggtggtgcgctgcgctacatcgattcgatcggcgtc
gccgagttcgtcgcgatggccgacaagtacgccgacctgggcccgctgtaccacccgacc
gcgaagctgcgcgagatggctgccaacggccagcgcttctacggttaa

DBGET integrated database retrieval system