KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1631Help
Entry
PSTAB_1631        CDS       T01571                                 

Gene name
ycfO
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAB_1631 (ycfO)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PSTAB_1631 (ycfO)
Enzymes [BR:psz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSTAB_1631 (ycfO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1708453..1709451
Genome map
AA seq 332 aa AA seqDB search
MHGSLMLDIAGTWLTAEDRHLLRQPEVGGLILFARNIESPRQVEELCRAIRAVRPDLLLA
VDQEGGRVQRLRQGFVRLPAMRELARCTDAPRLAEACGWVMASEVLAVGLDFSFAPVLDL
DHQRSAVVGARAFEGDPQVAVTLIDAFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPVD
ERSLDELRRCDLIPFMALSGTLDAIMPAHVIYPQVDEQPAGFSRRWLQDILRNELGFKGV
IFSDDLSMAGAHVAGDAAQRIESALGAGCDMGLVCNDRGAAELALTALQRLKVTPSTALA
GMRGRAGCPADYKQNPRWLDAIGALKAADLID
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcacggttcattgatgctggacatcgccggtacctggctgactgccgaggatcggcac
ctgctgcgccaacccgaagtgggtgggctcattctgttcgctcgcaatatcgagtctccg
cgacaggtggaggaactgtgccgtgcgatccgcgccgtgcgccccgatctgctgctggcg
gtggatcaggaaggcggccgcgtgcagcggctgcgccagggtttcgtgcggcttccggca
atgcgcgaactggcgcgttgcaccgacgctcccaggctggccgaagcctgtggctgggtc
atggccagcgaggtgcttgcggtgggcctggatttcagcttcgcgccggttctcgatctg
gatcatcagcgcagcgcggtggtaggcgcacgcgccttcgagggtgacccgcaggtcgcg
gtgacgctgatcgacgcctttattcgcggcatgcatgccgccggcatggccgccactggc
aagcacttccccgggcacggctgggctgaggccgattcgcatgtcgcgataccggtggat
gagcgcagcctcgacgagctgcgccgctgtgatctgattccctttatggcgctgagtggc
acgctcgatgcgatcatgccggcgcatgtcatctatcctcaggtcgacgagcagcccgcc
ggtttttcccggcgctggttgcaggacatcctgcgcaacgagctgggcttcaaaggcgtg
atcttcagcgacgatctctcgatggccggagcgcatgtcgcaggcgacgcggcgcagcgg
atcgaatccgctctgggcgctggttgcgacatggggctggtctgcaacgatcgtggggcc
gcagagctggcgctgactgcgctgcagcgcttgaaggtgacgccgtcgaccgcgctggcg
ggaatgcgtggccgggcgggctgcccggcggactacaagcagaaccctcgctggctggac
gccatcggcgcgctgaaggctgccgatctgattgactga

DBGET integrated database retrieval system