KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1638Help
Entry
PSTAB_1638        CDS       T01571                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAB_1638
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAB_1638
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSTAB_1638
Enzymes [BR:psz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSTAB_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1714967..1716175)
Genome map
AA seq 402 aa AA seqDB search
MSSDPRFTAMPDANGYFGPYGGQLVPPHLKQAMDDINLAYEEIRQREDFQQELAALFADY
VGRPSPIFHARRLSEQLGGAQIHLKREDLNHTGAHKINHCLGEALLARFMGKTKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMKILGCKLVAVTRGAATLKEAVD
SAFEEYLKDPQNYLYAIGSVVGPHPFPKMVRDFQSIIGQEARGQFLARHGRLPDQVVACV
GGGSNAMGIFTAFLEDAAVELVGIEPAGESLDKPGRHSATLSKGKPGELHGMACYVLEDA
EGNPSAVHSIASGLDYPGVGPQHSYLKDIGRVNYQTATDQECLDAFMTLSRVEGIIPALE
SAHAVAWAIRTAPTLGKDSHILVNLSGRGDKDADYVAKLLGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgatcctcgtttcactgccatgcccgacgccaacggctacttcggcccctac
ggtggccagctggtgccgccgcacctcaagcaggcgatggacgacatcaacctggcctac
gaagagatccgccagcgcgaggatttccagcaggaactggcagccctgttcgccgactac
gtgggccggccgagcccgatcttccatgcccggcgcctctccgagcagctcggtggcgcg
cagattcacctgaagcgcgaggacctgaatcacaccggggcacacaagatcaatcactgt
ctgggcgaggcactgcttgcccggttcatgggcaagaccaaggtgatcgccgagaccggc
gccggccaacacggtgtcgccctggccaccgcctgcgcgctggtgggcatcccctgcgaa
atccacatgggccaggtggacatcgagaaggaacatcccaacgtcaccaagatgaagatc
ctcggctgcaagctggtggcggtcacccgaggcgcggcgacgctcaaggaagcggtggac
agcgccttcgaggaatacctgaaggatccgcagaactacctctacgccatcggctcggtg
gtaggcccgcatccgttcccgaagatggtccgcgatttccagtcgatcatcggtcaagag
gcgcgcggccagtttctcgccaggcatggtcgcctgccggaccaggtggtcgcctgcgtc
ggcggcggttccaatgccatgggcatcttcacagccttcctggaagacgccgcggtcgag
ctggtgggcatcgagccggcgggcgaaagcctggacaagcccggccgccattcggccacc
ctgtccaagggcaaacccggtgaactgcacggcatggcctgctacgtgctggaagatgcc
gagggcaacccgtccgcagtgcactccatcgcctccggcctggactatcccggcgtcggc
cctcagcacagctacctcaaggacatcggccgggtgaactaccagaccgcgaccgaccag
gagtgtctggatgccttcatgaccctgtcgcgcgtcgaaggcatcatccccgccctggaa
agtgcccacgcggtggcctgggcgattcgcaccgcgccgacgctgggcaaggacagccac
atcctggtcaacctctccggccgcggcgacaaggatgccgactacgtcgccaagctgctc
ggcctgtaa

DBGET integrated database retrieval system