KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1773Help
Entry
PSTAB_1773        CDS       T01571                                 

Gene name
kgdB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00020  Citrate cycle (TCA cycle)
psz00310  Lysine degradation
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01200  Carbon metabolism
Module
psz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTAB_1773 (kgdB)
  Amino acid metabolism
   00310 Lysine degradation
    PSTAB_1773 (kgdB)
Enzymes [BR:psz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSTAB_1773 (kgdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEJ05054
UniProt: F8H874
Position
1863621..1864853
Genome map
AA seq 410 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVMEVLAEADGVLTEIV
KNEGDTVLSGELLGKLEAGAAAAAAPAQAAAPAPAPAAAAPAAAASAGGEEPILAPAARK
LAEENGIDPNSIRGTGKDGRVTKEDVVAAVEAKKSAPAAAAKPAAPAAAAPIFAEGDRVE
KRVPMTRLRAKVAERLVEAQSSMAMLTTFNEVNMKPIMELRAKYKDLFEKTHNGVRLGFM
SFFVKAAVEALKRQPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEHMSLAEI
EGGINEFGKKAKAGKLTIEEMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERP
MAVNGQVVILPMMYLALSYDHRLIDGKEAVTFLVTMKDLLEDPARLLLDI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccctacattcccggaatcggtcgccgacggcaccgttgcc
acctggcacaagcagccgggcgacgcggttaagcgtgatgaactgatcgtcgacatcgaa
actgacaaggtggtcatggaagtactggccgaagcagacggcgtgctgaccgagatcgtc
aagaacgaaggcgacaccgtgctgagcggcgagctgctcggcaagctggaagcaggcgct
gctgccgccgctgcacccgctcaagctgccgccccggccccggccccggccgctgctgct
ccggcagccgctgccagcgcgggtggcgaagagccgatcctggccccggcggcccgcaag
ctggccgaagagaacggtattgatccgaacagcatccgcggtaccggcaaggacggtcgc
gtgaccaaggaagacgtcgtcgccgccgtcgaagccaagaagtccgctccggctgccgct
gccaagccggccgctcctgccgctgcggctccgatcttcgccgagggtgatcgcgtcgag
aagcgcgtgccgatgacccgcctgcgtgccaaggtcgccgagcgtctggtcgaagcccag
tcctccatggctatgctgactacgttcaacgaagtcaacatgaagccgatcatggaactg
cgcgccaagtacaaggacctcttcgagaagacccataacggcgtgcgcctgggcttcatg
tccttcttcgtcaaggctgcggtggaagcgctcaagcgccagccgggcgtcaatgcctcc
atcgacggcaacgacatcgtctaccacggttatcaggacatcggcgtcgccgtttccagc
gaccgcggtctggtggtgccggtcctgcgtaacgccgagcacatgagcctggcggagatc
gaaggcggcatcaacgagttcggcaagaaggccaaggccggcaagctgaccatcgaggaa
atgactggcggtaccttcaccatctccaacggtggtgtgttcggttccctgctgtcgacc
ccgatcgtcaacccgccgcagactgccatcctcggcatgcacaagattcaggaacgtccg
atggccgtcaacggtcaggtggtcatcctgccgatgatgtacctggcgctgtcctatgac
catcgcttgatcgacggcaaggaagctgtgaccttcctggttaccatgaaggacctgctg
gaagacccggcccgtctgctgctggatatctga

DBGET integrated database retrieval system