KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1775Help
Entry
PSTAB_1775        CDS       T01571                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00020  Citrate cycle (TCA cycle)
psz00640  Propanoate metabolism
psz00660  C5-Branched dibasic acid metabolism
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01200  Carbon metabolism
Module
psz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTAB_1775 (sucC)
   00640 Propanoate metabolism
    PSTAB_1775 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PSTAB_1775 (sucC)
Enzymes [BR:psz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSTAB_1775 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AEJ05056
UniProt: A0A0H3YZD6
Position
1866579..1867745
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDSPKEAAEACDKIGGTQWVVKAQVHAGGRGKAGGV
KLVRSKDEARAFAQQWLDKRLVTYQTDANGQPVSKILVEACTDIDKELYLGAVVDRASRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPFQARELAFQLGLKGDQVKQFVHI
FVGLAQLFQDYDLALLEVNPLVIKTDGNLHCLDAKINIDSNAIYRQPKLRDMADPSQDDP
REAHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGAPANFLDVGGGATEERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVREVGVKVPVVVRLEGNNADLGAKM
LSESGLNIIGANSLTDAAIQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtaccaaggtaaacaactgttcgctgaatacggtctgcccgtgtcc
aaaggctatgcggtagatagcccgaaggaagcagcggaagcctgcgacaagatcggcggc
acacaatgggtggtcaaggcccaagtgcatgccggtggacgtggcaaggcgggtggcgta
aagctggttcgcagcaaggatgaggcccgggcgttcgcccagcagtggctcgacaagcgt
ctggtgacctaccagaccgatgccaatggtcagccggtcagcaagattctggtcgaggcg
tgcaccgatatcgacaaggagctctacctgggcgccgtggtcgatcgcgccagtcgccgg
atcgtcttcatggcgtcgaccgaaggtggcgtggacatcgaaaaagtcgctcacgacacg
cccgagaagatcctcaaggccaccatcgatccgctggtaggcgcgcaacccttccaggcg
cgcgaactggcgttccagttgggcctcaagggtgaccaggtcaagcagttcgtacacatc
ttcgtcggcctcgcccagctgttccaggactatgacctggccctgctggaagtgaacccg
ctggtgatcaagaccgacggcaatctgcactgcctggacgccaagatcaacatcgacagc
aacgccatctatcgccagccgaagctgcgcgacatggccgacccgtcacaggacgatccg
cgcgaggcgcatgctgccaagtgggagctgaattacgtggcgctcgacggcaacatcggt
tgcatggtcaacggtgccggtctggccatgggcaccatggacatcgtcaacctgcacggc
ggcgcgccggcgaacttcctcgacgtgggcggtggcgccaccgaggagcgcgtgaccgaa
gcgttcaagatcattctctccgacagcaatgtcgctgcggttctggtgaacatcttcggt
ggcatcgtgcgttgcgacatgatcgccgagggcatcatcggtgccgtgcgtgaagtgggg
gtcaaggtgccggtggtggtgcggctggaaggcaacaacgccgacctgggcgccaagatg
ctgagtgagagcggtctgaacatcatcggtgcgaacagcctgaccgatgcggccattcag
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system