KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1919Help
Entry
PSTAB_1919        CDS       T01571                                 

Gene name
tesA
Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSTAB_1919 (tesA)
Enzymes [BR:psz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSTAB_1919 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSTAB_1919 (tesA)
Lipid biosynthesis proteins [BR:psz01004]
 Fatty acid synthase
  Component type
   PSTAB_1919 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2031000..2031605
Genome map
AA seq 201 aa AA seqDB search
MRRWLKCGALALLCWTQGALAGTVLVVGDSISAAFGLETSQGWVHLLQERLVEGDESWRV
VNASISGDTTAGGLARLDPLLEEHTPEVVILELGGNDGLRGQSPVQLKQNLADMIDRSRE
AGAEVLLLGMRMPPNLGQRYTRAFADAFDSLAQEKSVAYVPFLLEGVGGVAGMMQADGIH
PTAEAQSQLLETVWPALEPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggtggctgaaatgcggggccctggcgctgctgtgctggactcagggagccctg
gccggaaccgtactggtggtcggcgatagtatcagcgccgctttcgggctggaaaccagc
cagggctgggtgcatctgctgcaggaacgcctcgtcgagggcgatgaatcctggcgtgtg
gtgaacgcctccatcagtggcgataccacggctggcgggcttgccaggctcgatcccctg
cttgaggaacatacccctgaagtggtcattctggagctgggcggcaatgacggattgcgt
gggcaatcacctgtgcaattgaaacagaatcttgccgacatgatcgatcgcagccgcgaa
gccggtgctgaagtgttgctgctgggcatgcggatgccgccgaatctggggcagcgctat
acccgtgcattcgccgatgcgttcgactcgcttgcgcaggaaaagagcgtcgcctacgtg
ccgttcctgctggagggtgtagggggtgttgccgggatgatgcaggccgacggcatccat
ccgactgccgaggcgcagagccagttgctcgagacggtctggccggcactcgagcccttg
ctttga

DBGET integrated database retrieval system