KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2001Help
Entry
PSTAB_2001        CDS       T01571                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSTAB_2001 (galU)
   00052 Galactose metabolism
    PSTAB_2001 (galU)
   00500 Starch and sucrose metabolism
    PSTAB_2001 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAB_2001 (galU)
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSTAB_2001 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2121900..2122739
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTQIAMVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIG
DEPFAVVLADDLCINLDGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRD
DIFRVSHMVEKPKPEDAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALMKQAKD
GCVLAYKFKGQRFDCGSAEGYIEATNFCYENFYLTGKAF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctttttcccgctgccggatatggcacccgttttctccccgcaacc
aaggccatgcccaaggaaatgctgccggtggtgaacaagccgctgatccagtacggggta
gaggaggcgctggcggcagggctcacgcagatcgccatggtcaccgggcgcggcaagcgc
tcgctcgaagaccacttcgatatcagctatgagctcgagcatcagattcgcaacaccgac
aaggaaaagtacctcgtcggtattcgtcgcctgatcgacgagtgcagcttttcctacacc
cgtcaggtggaaatgaaggggctgggccacgcgattctcagcggccgtccgctgatcggt
gacgagccgttcgccgtggtgctggcagacgacctgtgcatcaacctcgatggcgacccg
gtgctggcgcagatggtcaaactgtacaaccagttccgctgctcgatcgtggcgatccag
gaagtaccgccggaagaaaccagcaagtacggcgtgattgccggcgagatgattcgcgac
gacatcttccgcgtcagccacatggtcgaaaagcccaagccggaagacgccccgtcgaac
ctggcgatcatcggccgttacatcctaaccccggacatcttcgagctgatcgagcagacc
gagccgggcaagggcggtgaaatccagatcaccgacgcgctgatgaagcaggcaaaggac
ggttgcgtgctggcctacaaattcaaaggacagcgtttcgactgcggtagcgccgagggt
tacatcgaggcgaccaacttctgctacgagaacttctacctcaccggtaaggcgttctga

DBGET integrated database retrieval system