KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2027Help
Entry
PSTAB_2027        CDS       T01571                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSTAB_2027 (malQ)
Enzymes [BR:psz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PSTAB_2027 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2150660..2152735
Genome map
AA seq 691 aa AA seqDB search
MSDEALIRLADAAGLSIDWVDADNRQQRVEPQVLREVLGCLGLEADTDQQIEASLKVIAH
QNNHGGVPPLLTCDQNAVLELAAYFPPSSRYELVAEQGDVLHGTLDDQARLHVPDTPGYH
RLRIDETELIVAVAPPSCPTVAQLAGPNAWGLTAQLYSLRRPGDGGLGDTQALEALVRNA
GAHGADVLGISPVHAMFGAHINQYSPYSPSSRLFYNVLHAAPGSILGEWPVRQAIEACRL
GEELERLERLDLIDWPAVAQSRQRLLRQLFDDFSQGENPQQADFDSFRANGGEALENHCR
FEALHQHLRDAEGHPQHWRNWPQDYRDPASPAVERFAREHADEVSYHAFGQWLMARGLER
AQVAARSAGMRIGLVSDLAVGADGGGSQAWSRQGELLASLSVGAPPDVMNRDGQNWGISA
FSPWGLRQHGFRAYIEMLRANLAHAGGMRIDHVLGLKRLWVVPAGADPKRGVYLNFPFDD
MLRLLCLEAWRHQAVILGEDLGTIPHGFRDVLAAKGILGMRVLLFEQHDGHFQRADQYSD
QALATSTTHDIPTLRGWWNGHDIDWRIKVGQVQEADRDQQWRSREHERAGLNRALCEDGG
KDPHHLLSAEQAVDAAACFLGHTRAPLVLFPVEDALGLEEQTNMPGIVETHPNWRRRYPG
DSATLLDGEASRRRLECLAQARRNHRGAAHR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgaagccctgatccgcctggctgacgcagccgggttgtccatcgactgggtg
gacgccgacaaccgtcagcagcgggtggagccgcaagtactgcgtgaagtgctcggttgc
ctcggactcgaggcagataccgatcagcagatcgaagccagcctgaaagtcatcgcgcat
cagaacaaccacggcggtgtaccgccgctgctgacctgcgaccagaacgccgtgctggag
ctggcggcctacttcccgccgtccagccgttacgaactggtggccgaacagggcgacgtg
ctgcacggcacgctggacgaccaggcacggctgcatgtgccggacaccccgggctatcac
cgcctgaggatcgacgagaccgaactgatcgtggcggtcgcgccgccctcgtgccccacg
gttgcgcagctcgcaggcccgaacgcctgggggctgacggcccagctgtacagcctgcgc
cgaccaggcgacggcgggctgggcgacacccaggcgctggaagccctggtgcgcaatgcc
ggtgcccatggagccgacgtgctaggcatcagcccggtgcatgccatgttcggtgcgcat
atcaatcagtacagtccctactcgccctccagccgcctgttttacaacgtgctgcacgca
gcgccgggctccattctcggcgaatggccggtgcgtcaggccatcgaggcgtgcagactc
ggcgaggagctggagcgcctcgagcgactggacctgatcgactggcctgccgtggcgcaa
tcgcgtcagcgcctgctgcgccagctgttcgacgacttcagccagggcgagaacccgcaa
caggccgatttcgacagttttcgcgccaatggcggcgaagcgctggagaaccattgccgt
ttcgaggcgctgcaccagcatctgcgtgacgccgaaggccatccgcagcattggcgcaac
tggccgcaggactaccgcgacccggccagcccggcagtggaacgcttcgcccgcgaacat
gccgacgaggtcagctatcacgccttcggccagtggctgatggcgcgcgggctcgagcgc
gcacaggttgccgcacgcagcgcaggcatgcgcatcggtctggtctccgaccttgccgtc
ggcgccgacggcggtggcagccaggcctggagccgccagggcgaactgctcgcttcgctg
agcgtcggcgcaccgccggacgtgatgaaccgcgacggacagaactggggcatctccgcg
ttctcgccctggggcctgcgtcagcatggcttccgagcctatatcgaaatgctgcgcgcc
aatctcgcccacgccggcggcatgcgcatcgaccacgtgctgggcctcaagcgcctgtgg
gtggtgccggccggcgccgaccccaagcgcggcgtgtacctcaacttccccttcgacgac
atgctgcgcctgctctgcctggaggcctggcggcatcaggcggtgatcctcggcgaggat
ctcggcaccattccccacgggtttcgtgacgtgctcgccgccaagggcatcctcggcatg
cgggtactgctgttcgaacagcacgacggccatttccagcgtgccgaccagtattccgac
caggccctggcgaccagtaccacccacgacatcccgaccctgaggggctggtggaacggc
catgacatcgactggcgcatcaaggtcggtcaggtgcaggaagccgatcgcgatcagcaa
tggcgttcccgcgaacatgagcgcgccgggctcaaccgtgcgctctgcgaggatggcgga
aaagatcctcatcatctgctgagcgccgaacaagccgtcgatgccgccgcctgttttctc
ggccacacccgcgcgccgctggtgctgtttccggtcgaggacgccctcggcctggaggaa
cagaccaacatgccgggcatcgtcgaaacccaccccaactggcgtcgccgctatcccggc
gacagtgcaacgctgctcgacggcgaagccagccgccggcgcctggaatgcctggcgcag
gcacgccgcaaccatcgtggagctgcgcatcgatga

DBGET integrated database retrieval system