KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2040Help
Entry
PSTAB_2040        CDS       T01571                                 

Gene name
glgB
Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSTAB_2040 (glgB)
Enzymes [BR:psz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PSTAB_2040 (glgB)
Exosome [BR:psz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSTAB_2040 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2167663..2169876)
Genome map
AA seq 737 aa AA seqDB search
MTDRPALTMPGETLMPSDADVDALVRAEHGNPFSILGPHPDGEAMVVRAYLPNALGAEVL
DRNQQLLTVMEQGQVPGFFVARLTHQQPYLLRIRWAGGEQITEDPYSFGPQLGELDMHLF
SEGNHRQIGRVFGSQVIEVDGVQGVRFAVWAPNARRVSVVGSFNGWDGRRHPMRLRFPSG
VWELFIPRLQPGDTYKYEILGPNGILPLKADPVALATEHPPGTASVIARPLDYQWKDQAW
LQQRSARQSLEAPMSIYELHAGSWRREGGDDGRMYNWHELAERLIPYVVDMGFTHIELMP
IMEHPFGGSWGYQLLSQFAPSARYGNAHDFAEFVDACHNAGIGVILDWVPAHFPTDAHGL
GEFDGTALYEYAHPFEGFHQDWDTYIYNLGRTEVHGFMLASALHWLREFHVDALRVDAVA
SMLYRDYSRKDGEWIPNRHGGRENLEAIDFLRHLNDVVATETPGALVIAEESTAFPGVSK
PTSEGGLGFSYKWNMGWMHDTLKYIQEDPIHRQYHHDKLTFGMVYAYSEHFVLPISHDEV
VHGKGSLIDKMPGDRWQKFANLRAYLSFMWTHPGKKLLFMGSEFGQWREWNHDRELDWHL
LEDADHRGVQNLVRDLNRLYSQEPALHELDSDPRGFQWLIGDDRANSVFAWLRKSSTGHP
LLVIGNFTPVVREGYRIGVPVDARWLEVFNSDAECYGGSNTGNGGGMLAEPVESHGEKVS
LSLTLPPLGVLVMRPQV
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcccggccctgaccatgccaggggagaccctgatgcctagtgacgccgat
gtagatgctctggtgcgagccgagcatggcaacccgttctccattctcgggccgcacccc
gatggcgaagcaatggtggtgcgcgcctacctgcccaacgcattgggcgcggaagtgctg
gaccgcaaccagcaattgctgacggtgatggagcagggccaggtgcccggcttcttcgtc
gcccgtctgactcaccagcaaccttacctgctgcgcatccgctgggccggtggtgagcag
atcactgaagacccgtacagcttcggtccgcagctgggcgagctggacatgcatctgttc
tccgagggcaaccatcggcagatcggccgggtgttcggttcccaagtgatcgaggtcgac
ggcgtgcagggtgtgcgtttcgccgtctgggcacccaatgcgcggcgcgtctcggtagtc
ggcagcttcaatggctgggacggacgccgacacccgatgcggctgcgctttccgtctggc
gtatgggagctgttcattccgcgcctgcagcccggcgatacctacaagtacgagattctc
ggccccaacggcatcctgccgctgaaggctgatcccgtcgcactcgccaccgagcatccg
ccgggaaccgcatcggtcatcgcccggccactggattatcagtggaaggaccaggcctgg
ctgcaacagcggtccgcgcgccagtcactcgaggcgccgatgagcatctacgagctgcat
gccgggtcgtggcgacgcgagggtggcgacgacgggcgaatgtacaactggcacgagctg
gccgagcggctgatcccttacgtggtggacatgggcttcacccatatcgagctgatgccg
atcatggagcacccgttcggcggctcctggggctaccagctgctttcgcagttcgctccc
agcgcgcgctacggtaacgcccacgacttcgccgagttcgtcgacgcctgccataacgcc
ggtatcggcgtgatcctcgactgggtgccggcgcatttccccaccgacgctcatggcctg
ggcgagttcgatggcactgcgctgtacgagtacgcccacccgttcgagggcttccaccag
gactgggatacctacatctacaacctcggccgcaccgaggtgcacggcttcatgctggcc
tcggcgctgcattggctgcgcgagttccacgtcgatgcgctgcgcgtggatgcggtggcc
tcgatgctctaccgggattattcgcgcaaggacggcgaatggattcccaaccgccatggc
gggcgcgagaacctggaggcgatcgatttccttcgtcacctgaacgatgtggtggccacc
gagacccccggcgcgctggtgatcgccgaggagtccaccgcctttcccggcgtcagcaag
ccgaccagtgaaggtgggctgggcttttcctacaagtggaacatgggctggatgcacgac
acgctcaagtacatccaggaagatccgatccaccggcagtaccatcacgacaagctgacc
ttcggcatggtctacgcctattccgagcatttcgtgctgccgatctcccatgacgaggtg
gtgcacggcaagggctcgctgatcgacaagatgccgggcgaccgctggcagaagttcgcc
aacctgcgcgcctacctgtcattcatgtggacccacccgggcaagaagctgctgttcatg
ggcagcgagttcggtcagtggcgcgagtggaaccacgaccgcgagctggattggcatctg
ctggaagacgccgatcaccgtggcgtgcagaacctggtgcgcgaccttaaccgcctgtat
agccaggagccggcgctgcacgaactggacagcgacccgcgcggtttccagtggctgatc
ggcgacgatcgcgccaacagcgtgttcgcctggctgcgcaagagttcgaccggccatccg
ctgctggtgatcggcaacttcaccccggtggtgcgcgagggttatcgcatcggtgtgccg
gtggatgccaggtggctggaggtgttcaacagcgacgccgaatgctacggcggttccaac
accggcaacggcggcggcatgctggccgagccggtggagagtcacggcgagaaggtttcg
ctgtcgctgaccctgccgccactgggcgtgctggtaatgcgaccgcaggtctga

DBGET integrated database retrieval system