KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2134Help
Entry
PSTAB_2134        CDS       T01571                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00071  Fatty acid degradation
psz00280  Valine, leucine and isoleucine degradation
psz00281  Geraniol degradation
psz00310  Lysine degradation
psz00360  Phenylalanine metabolism
psz00362  Benzoate degradation
psz00380  Tryptophan metabolism
psz00410  beta-Alanine metabolism
psz00627  Aminobenzoate degradation
psz00640  Propanoate metabolism
psz00650  Butanoate metabolism
psz00903  Limonene and pinene degradation
psz00930  Caprolactam degradation
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01212  Fatty acid metabolism
Module
psz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSTAB_2134
   00650 Butanoate metabolism
    PSTAB_2134
  Lipid metabolism
   00071 Fatty acid degradation
    PSTAB_2134
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTAB_2134
   00310 Lysine degradation
    PSTAB_2134
   00360 Phenylalanine metabolism
    PSTAB_2134
   00380 Tryptophan metabolism
    PSTAB_2134
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSTAB_2134
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSTAB_2134
   00281 Geraniol degradation
    PSTAB_2134
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSTAB_2134
   00627 Aminobenzoate degradation
    PSTAB_2134
   00930 Caprolactam degradation
    PSTAB_2134
Enzymes [BR:psz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSTAB_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Herpes_ori_bp Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEJ05415
UniProt: F8GZF4
Position
complement(2281942..2282754)
Genome map
AA seq 270 aa AA seqDB search
MTEYKAFRVELADKIARVVINRPEKINAMDAAFWTEIIDIFNWVDATDDVRVVVLSGAGE
HFSSGIDLQLLASVGSQLGSDVGRNAEQLRRKILSLQASFNAVDNCRKPVLAAIQGYCLG
GAIDLISACDMRYSTVDAKFSIKEIDMGMAADVGTLQRLPRIIGDGMMRELAFTGRTIRG
DEARSIGLVNRTYADQQALMEGVLELARDIASKSPIAIRGTKEMIRYMRDHRVDDGLEYI
ATWNAAMLQSADIKVAIAAHMSKQKPDFAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaatacaaagccttccgcgtagagttggcagacaagattgcccgagtcgtgatc
aaccgacccgagaagatcaatgcgatggatgccgcgttctggacggaaatcatcgatatc
ttcaattgggtcgatgccacggatgacgtgcgtgtagtggtcctcagcggggccggggag
catttctcatcaggcatcgaccttcagctgctggcctcggtgggtagccagctgggtagc
gatgtcgggcgcaatgccgagcagctgcggcgcaagatcctgtcgttgcaggcttcgttc
aacgcggtcgacaactgccgcaagcctgtcctcgctgcgatccagggctattgcctgggg
ggcgccatcgatctcatctcggcgtgcgacatgcgttacagcacggtggatgcgaagttc
tcgatcaaggagatcgacatgggcatggccgccgatgtcggtacactgcagcgcctgcca
cgtatcatcggcgacggcatgatgcgcgagctggccttcaccggccgcaccatccgcggt
gatgaggcgcgcagcatcggtctggtcaatcgcacctacgccgatcagcaggcgctgatg
gagggtgtgctggagctggcccgcgacatcgccagcaagtcaccgatcgccatccgtggc
accaaggaaatgatccgctacatgcgcgaccaccgcgtcgacgatggtctcgaatacatc
gccacctggaatgcggccatgctgcagtcggccgatatcaaggttgccatcgccgctcac
atgagcaaacagaagccggactttgccgactga

DBGET integrated database retrieval system