KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2196Help
Entry
PSTAB_2196        CDS       T01571                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00630  Glyoxylate and dicarboxylate metabolism
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSTAB_2196 (aceA)
Enzymes [BR:psz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSTAB_2196 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEJ05477
UniProt: F8H025
Position
2352748..2354343
Genome map
AA seq 531 aa AA seqDB search
MSAYQDDIKAVAALKEQYGSSWAAINPESVARMRAQNRFKTGLEIAQYTADIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDNAKAAEIQNQIDNYETHIVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
AAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDCEEISEAELG
NGDVVIKREGKLLRPKRLPSNLFQFRAGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
ETELAKVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADQGMLAYVK
GVQREELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcaagacgacatcaaggcagttgccgccctgaaagagcaatacggcagc
agctgggccgccatcaaccctgagtccgtcgctcgcatgcgcgcccagaaccgcttcaag
accggtctggaaatcgctcagtacaccgccgacatcatgcgcaaggacatggccgagtac
gacgccgactcgtccgtctacacgcagtccctcggctgctggcacggcttcattggtcag
cagaagctgatctccatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggctggatggttgctgctctgcgttccgagttcggcccgctgccggaccagtccatg
cacgagaagaccgccgtttccgacctgatcgaggagctgtacaccttcctgcgtcaggct
gacagccgcgaactggacctgctgttcaccgccctggacgctgctcgtgaagctggcgac
aacgccaaggctgccgagatccagaaccagatcgacaactacgaaacccacatcgtaccg
atcatcgctgacatcgacgctggcttcggtaacccggaagccacctacctgctggccaag
cgcatgatcgaagcaggcgcttgctgcatccagatcgagaaccaggtttccgacgagaag
cagtgcggccaccaggacggtaaagtaaccgttccgcacgccgacttcctcgccaagatc
gctgccgttcgttacgccttcctcgagctgggcatcgacaacggcgtgatcgttgctcgt
accgactccctgggtgccggcctgaccaagcagattgccgtgaccaaagagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagaaatctccgaagccgagctgggc
aatggcgacgtcgtaatcaagcgcgaaggcaagctgctgcgtccgaagcgtctgccgtcc
aacctgttccagttccgcgctggcaccggcgaagaccgctgcgttctggactgcatcacc
tcgctgcagaacggcgccgacctgctgtggatcgaaaccgagaagccgcacgttggccag
atcaaggccatggttgaccgcattcgcgaagtcatcccgaacgccaagctggtctataac
aacagcccgtccttcaactggacgctgaacttccgtcagcaggtgttcgacgctttcgtt
gccgaaggcaaggacgtgtccgcctacgaccgcgccaagctgatgagcgtcgagtacgac
gaaaccgagctggccaaggttgcagacgagaagatccgtaccttccagcgcgacggttcg
gctcacgccggcatcttccaccacctgatcaccctgccgacctaccacactgctgctctg
tcgaccgacaacctggccaagggctactttgccgaccagggcatgctggcctacgtcaag
ggcgttcagcgcgaggaactgcgtcagggtatcgcctgcgtcaagcaccagaacatggct
ggctctgacatcggcgacaaccacaaggagtacttcgctggcgaagctgctctgaaggca
agcggcaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system