KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2213Help
Entry
PSTAB_2213        CDS       T01571                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2376239..2376784
Genome map
AA seq 181 aa AA seqDB search
MSLEQHYTAILGQLGEDVNREGLLDTPKRAAKAMQYLCKGYQQTLEEVTNGALFSSDNSE
MVLVKNIELYSLCEHHMLPFIGKAHVAYLPNGKVLGLSKVARIVDMYARRLQIQENLTRE
IAEAMQQVTGASGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGQFRDNAATRSEFLGLV
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacaacactacaccgcgatccttggccaacttggcgaggacgttaaccgc
gagggtctgctcgacacacccaaacgcgccgccaaagccatgcagtacctgtgcaagggc
taccagcagaccctcgaagaggtgaccaacggcgctctgttcagctccgacaacagcgag
atggtgctggtcaagaacatcgagctgtactcgctctgcgaacaccacatgctgcctttc
atcggcaaggcgcacgtcgcctacctgcccaacggtaaggtgcttggcctgtcgaaggtc
gcccggatcgtcgacatgtatgcgcgccgactgcagattcaggaaaacctgacccgtgag
atcgccgaagcgatgcagcaggtcaccggagcctccggtgtagccgtggtcatcgaagcc
cagcacatgtgcatgatgatgcgcggtgtcgagaagcagaattcctccatggtcacatcg
gtgatgctgggtcagttccgcgacaatgccgctactcgtagcgagtttctcgggctggtg
aagtag

DBGET integrated database retrieval system