KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2229Help
Entry
PSTAB_2229        CDS       T01571                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PSTAB_2229
Enzymes [BR:psz01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     PSTAB_2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2399363..2400367
Genome map
AA seq 334 aa AA seqDB search
MLTDALAHFPRLELITTPTPLEHLPRLSRHLGRDIWIKREDLTPLALGGNKARKLEYLGA
DALALGADVLVTAGAIQSNHVRQTAALAARQGLGCLALLENPLGTNEDNYLGNGNRLLLD
LFGSEVEAVANLDNADELLQAAAQRLRSAGRKPYLVPIGGSNALGALGYVRAGLELAEQM
HGAGEDFAAVALASGSAGTHSGLALALAHARPSSRVVGVTVSRPQATQRPKVEELLQRTA
ELLGVQVPAGLQVELWDQYFAPRYGEPNAATLAAIRLLAEQEGVLLDPVYTGKAFAGLLD
GLARGAFPGTGPLLFLHTGGAPALFAYYPWALGA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgacgccctcgcccacttcccgcgccttgaattgattaccacccccacgccc
ctggaacacttgccgcgactgtcgcgtcatctgggccgtgatatctggatcaagcgcgaa
gacctcaccccgctggccctcggtggcaacaaggcgcgcaagctcgaatacctcggtgcc
gacgccctggctctgggcgccgatgtgctggtaaccgccggtgccatccaatccaaccat
gtgcgccagaccgcagccctggcggccagacagggtcttggctgcctggcgctgctggag
aatccgctgggcacgaacgaggacaactacctaggcaacggcaaccgcctgctgctcgac
ctgttcggcagcgaggtcgaagcggtcgccaacctggataacgccgatgagttgctgcag
gcggcggcccagcgtctgcgcagcgctgggcgcaaaccctacctggtgcccatcggtggc
tccaatgcgcttggtgcgttgggctatgtacgcgccggcctggagctggccgagcagatg
catggcgcgggcgaggattttgccgccgtggccctcgcatccggcagcgccggaacccac
agcggcctggcgctggcgctagcgcatgcccggccgagcagccgggtggtcggggtcacg
gtgtcgcggccacaggcgacacagcggcccaaggtcgaggagctgctgcagcgcaccgcc
gagctgctcggcgtccaggttccagcgggactgcaggtcgaactgtgggaccagtatttc
gccccgcgctacggtgaaccgaatgccgccactctggccgcgatccgcctgctggccgaa
caggaaggcgtgctgctcgatccagtttacaccggtaaggccttcgccggcctgctcgac
gggctggcccggggcgccttccccggaacgggcccgctgctgtttctgcacaccggtggt
gccccggcattgttcgcctattatccatgggcactgggtgcataa

DBGET integrated database retrieval system