KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2229Help
Entry
PSTAB_2229        CDS       T01571                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:psz00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2399363..2400367
Genome map
AA seq 334 aa AA seqDB search
MLTDALAHFPRLELITTPTPLEHLPRLSRHLGRDIWIKREDLTPLALGGNKARKLEYLGA
DALALGADVLVTAGAIQSNHVRQTAALAARQGLGCLALLENPLGTNEDNYLGNGNRLLLD
LFGSEVEAVANLDNADELLQAAAQRLRSAGRKPYLVPIGGSNALGALGYVRAGLELAEQM
HGAGEDFAAVALASGSAGTHSGLALALAHARPSSRVVGVTVSRPQATQRPKVEELLQRTA
ELLGVQVPAGLQVELWDQYFAPRYGEPNAATLAAIRLLAEQEGVLLDPVYTGKAFAGLLD
GLARGAFPGTGPLLFLHTGGAPALFAYYPWALGA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgacgccctcgcccacttcccgcgccttgaattgattaccacccccacgccc
ctggaacacttgccgcgactgtcgcgtcatctgggccgtgatatctggatcaagcgcgaa
gacctcaccccgctggccctcggtggcaacaaggcgcgcaagctcgaatacctcggtgcc
gacgccctggctctgggcgccgatgtgctggtaaccgccggtgccatccaatccaaccat
gtgcgccagaccgcagccctggcggccagacagggtcttggctgcctggcgctgctggag
aatccgctgggcacgaacgaggacaactacctaggcaacggcaaccgcctgctgctcgac
ctgttcggcagcgaggtcgaagcggtcgccaacctggataacgccgatgagttgctgcag
gcggcggcccagcgtctgcgcagcgctgggcgcaaaccctacctggtgcccatcggtggc
tccaatgcgcttggtgcgttgggctatgtacgcgccggcctggagctggccgagcagatg
catggcgcgggcgaggattttgccgccgtggccctcgcatccggcagcgccggaacccac
agcggcctggcgctggcgctagcgcatgcccggccgagcagccgggtggtcggggtcacg
gtgtcgcggccacaggcgacacagcggcccaaggtcgaggagctgctgcagcgcaccgcc
gagctgctcggcgtccaggttccagcgggactgcaggtcgaactgtgggaccagtatttc
gccccgcgctacggtgaaccgaatgccgccactctggccgcgatccgcctgctggccgaa
caggaaggcgtgctgctcgatccagtttacaccggtaaggccttcgccggcctgctcgac
gggctggcccggggcgccttccccggaacgggcccgctgctgtttctgcacaccggtggt
gccccggcattgttcgcctattatccatgggcactgggtgcataa

DBGET integrated database retrieval system