KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2302Help
Entry
PSTAB_2302        CDS       T01571                                 

Definition
carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:psz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:psz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:psz00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:psz00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:psz00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:psz00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:psz00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2483491..2484426)
Genome map
AA seq 311 aa AA seqDB search
MPLIATLTLNPAMDLSVSTARVTDTQKLRCSAPRHDPGGGGINVARVVKTLGGKAVAVYP
AGGPFGDLLRRSLDELGLVHRPVPIVGDTRESFTVDELQSGLQYRFVLPGPVLSAQELER
CLQTLAALRPAPEYVVLSGSFPPGTDLAFFDDLRALTLRLGARLVVDLSGEPLCHAARHG
GVYLMKPSLEELSTLMGGAVTSEAEQQEALRSLIARGRAEIVVLSLGAEGALYAYGERLE
RLRSPQVPVVSAVGAGDSMLGAIVQALADGRSVDAAVRQGIAAGAATVMRPGTELCHRED
VQRLLEALERA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgattgcgaccctgaccctcaacccggcgatggacctttccgtcagtaccgcc
cgggtcaccgatacccagaagctgcgctgttcggcgcctcgccacgatcctggcggtggc
ggcatcaacgtggcccgggtggtaaagaccctcggtggcaaggcagtcgccgtgtaccca
gcgggtggtccgttcggcgatctgctgcggcgttcgctcgacgaactcggactggtgcat
cgccccgtgcccatcgtcggcgatacgcgggagagtttcaccgtcgatgagctgcaatcg
ggcctgcagtaccgcttcgtgctacctggtccggtgctgtcggcgcaggagctggagcgc
tgcctgcagacgctggcggcgctgcgtccggcgccagaatatgtcgtgctgagcggcagc
tttccgcccggcacggacctggccttcttcgatgacctgcgcgccctgaccctgcggctc
ggtgcccggctggtggtcgacctctccggtgagccgctatgccatgcggcccggcatggc
ggtgtgtacctgatgaagcccagtctcgaggagctttccaccctgatgggcggcgccgtg
accagcgaggccgagcagcaagaggccttgcgcagcctgatcgcccggggccgcgccgag
atcgtcgtactgtctctgggggccgagggtgcgctgtatgcctatggcgaacggctggag
cgcctgcgctcgccgcaggtgccggtggtcagcgcagtgggagcgggcgacagcatgttg
ggtgccatcgtgcaggcactggcggatgggcgttcggtagacgcggcggtgcgccagggc
atcgcggccggtgccgcgacggtgatgcggccgggcaccgagctgtgccatcgcgaggat
gtgcagcgcttgctcgaggcgctggagcgcgcctag

DBGET integrated database retrieval system