KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2302Help
Entry
PSTAB_2302        CDS       T01571                                 

Definition
(GenBank) carbohydrate kinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00010  Glycolysis / Gluconeogenesis
psz00030  Pentose phosphate pathway
psz00051  Fructose and mannose metabolism
psz00052  Galactose metabolism
psz00680  Methane metabolism
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01200  Carbon metabolism
psz01230  Biosynthesis of amino acids
Module
psz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_2302
   00030 Pentose phosphate pathway
    PSTAB_2302
   00051 Fructose and mannose metabolism
    PSTAB_2302
   00052 Galactose metabolism
    PSTAB_2302
  Energy metabolism
   00680 Methane metabolism
    PSTAB_2302
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PSTAB_2302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AEJ05583
UniProt: F8H0U3
Position
complement(2483491..2484426)
Genome map
AA seq 311 aa AA seqDB search
MPLIATLTLNPAMDLSVSTARVTDTQKLRCSAPRHDPGGGGINVARVVKTLGGKAVAVYP
AGGPFGDLLRRSLDELGLVHRPVPIVGDTRESFTVDELQSGLQYRFVLPGPVLSAQELER
CLQTLAALRPAPEYVVLSGSFPPGTDLAFFDDLRALTLRLGARLVVDLSGEPLCHAARHG
GVYLMKPSLEELSTLMGGAVTSEAEQQEALRSLIARGRAEIVVLSLGAEGALYAYGERLE
RLRSPQVPVVSAVGAGDSMLGAIVQALADGRSVDAAVRQGIAAGAATVMRPGTELCHRED
VQRLLEALERA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgattgcgaccctgaccctcaacccggcgatggacctttccgtcagtaccgcc
cgggtcaccgatacccagaagctgcgctgttcggcgcctcgccacgatcctggcggtggc
ggcatcaacgtggcccgggtggtaaagaccctcggtggcaaggcagtcgccgtgtaccca
gcgggtggtccgttcggcgatctgctgcggcgttcgctcgacgaactcggactggtgcat
cgccccgtgcccatcgtcggcgatacgcgggagagtttcaccgtcgatgagctgcaatcg
ggcctgcagtaccgcttcgtgctacctggtccggtgctgtcggcgcaggagctggagcgc
tgcctgcagacgctggcggcgctgcgtccggcgccagaatatgtcgtgctgagcggcagc
tttccgcccggcacggacctggccttcttcgatgacctgcgcgccctgaccctgcggctc
ggtgcccggctggtggtcgacctctccggtgagccgctatgccatgcggcccggcatggc
ggtgtgtacctgatgaagcccagtctcgaggagctttccaccctgatgggcggcgccgtg
accagcgaggccgagcagcaagaggccttgcgcagcctgatcgcccggggccgcgccgag
atcgtcgtactgtctctgggggccgagggtgcgctgtatgcctatggcgaacggctggag
cgcctgcgctcgccgcaggtgccggtggtcagcgcagtgggagcgggcgacagcatgttg
ggtgccatcgtgcaggcactggcggatgggcgttcggtagacgcggcggtgcgccagggc
atcgcggccggtgccgcgacggtgatgcggccgggcaccgagctgtgccatcgcgaggat
gtgcagcgcttgctcgaggcgctggagcgcgcctag

DBGET integrated database retrieval system