KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2302Help
Entry
PSTAB_2302        CDS       T01571                                 

Definition
carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSTAB_2302
   01230 Biosynthesis of amino acids
    PSTAB_2302
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_2302
   00030 Pentose phosphate pathway
    PSTAB_2302
   00051 Fructose and mannose metabolism
    PSTAB_2302
   00052 Galactose metabolism
    PSTAB_2302
  Energy metabolism
   00680 Methane metabolism
    PSTAB_2302
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PSTAB_2302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2483491..2484426)
Genome map
AA seq 311 aa AA seqDB search
MPLIATLTLNPAMDLSVSTARVTDTQKLRCSAPRHDPGGGGINVARVVKTLGGKAVAVYP
AGGPFGDLLRRSLDELGLVHRPVPIVGDTRESFTVDELQSGLQYRFVLPGPVLSAQELER
CLQTLAALRPAPEYVVLSGSFPPGTDLAFFDDLRALTLRLGARLVVDLSGEPLCHAARHG
GVYLMKPSLEELSTLMGGAVTSEAEQQEALRSLIARGRAEIVVLSLGAEGALYAYGERLE
RLRSPQVPVVSAVGAGDSMLGAIVQALADGRSVDAAVRQGIAAGAATVMRPGTELCHRED
VQRLLEALERA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgattgcgaccctgaccctcaacccggcgatggacctttccgtcagtaccgcc
cgggtcaccgatacccagaagctgcgctgttcggcgcctcgccacgatcctggcggtggc
ggcatcaacgtggcccgggtggtaaagaccctcggtggcaaggcagtcgccgtgtaccca
gcgggtggtccgttcggcgatctgctgcggcgttcgctcgacgaactcggactggtgcat
cgccccgtgcccatcgtcggcgatacgcgggagagtttcaccgtcgatgagctgcaatcg
ggcctgcagtaccgcttcgtgctacctggtccggtgctgtcggcgcaggagctggagcgc
tgcctgcagacgctggcggcgctgcgtccggcgccagaatatgtcgtgctgagcggcagc
tttccgcccggcacggacctggccttcttcgatgacctgcgcgccctgaccctgcggctc
ggtgcccggctggtggtcgacctctccggtgagccgctatgccatgcggcccggcatggc
ggtgtgtacctgatgaagcccagtctcgaggagctttccaccctgatgggcggcgccgtg
accagcgaggccgagcagcaagaggccttgcgcagcctgatcgcccggggccgcgccgag
atcgtcgtactgtctctgggggccgagggtgcgctgtatgcctatggcgaacggctggag
cgcctgcgctcgccgcaggtgccggtggtcagcgcagtgggagcgggcgacagcatgttg
ggtgccatcgtgcaggcactggcggatgggcgttcggtagacgcggcggtgcgccagggc
atcgcggccggtgccgcgacggtgatgcggccgggcaccgagctgtgccatcgcgaggat
gtgcagcgcttgctcgaggcgctggagcgcgcctag

DBGET integrated database retrieval system