KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2341Help
Entry
PSTAB_2341        CDS       T01571                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSTAB_2341
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_2341
   00052 Galactose metabolism
    PSTAB_2341
   00500 Starch and sucrose metabolism
    PSTAB_2341
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAB_2341
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSTAB_2341
   00524 Butirosin and neomycin biosynthesis
    PSTAB_2341
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSTAB_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2526650..2527612)
Genome map
AA seq 320 aa AA seqDB search
MKTALVGDIGGTNARFALWRDQRIEQLRVLPTADHARPELAIRAYLDEVGQPLDALEAVC
LACAGPVSGDHFRFTNNHWQLSRQAFCRELGLKDLLLINDFTAMALGMTRLRDDERVTVR
EGEPEPGRPRLVIGPGTGLGVAGLLPLVGGGWRALPGEGGHICLPIGSEREAAIWMQLHR
AQGHVNAEAVLSGPGLLTLYRACCALDGRAAEHDSPAEITKAALAGEPYAVAVLEQFCRW
LGRIVGDNVLTLGARGGVYIVGGVVPRFAEFFMHSGFCDALCEKGQMSGYFDRLPVWLVT
APYPGLEGAGVALQSLLEGV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgctggttggcgacatcggtggtaccaatgcacgcttcgcgctgtggcgc
gatcagcggatcgagcagcttcgcgtgctgcccacggcagaccatgcgcgtccggagctg
gcaatccgcgcctacctcgacgaagtgggccagccgctggatgcgctggaagcagtatgc
ctggcctgtgccgggccggtgagcggcgatcacttccgcttcaccaacaaccactggcag
ctgagccgacaggcgttctgccgcgaactgggcctgaaggatctgctgctgatcaacgac
ttcaccgccatggccctgggtatgacccggctacgcgatgacgagcgcgtcacggtccgc
gagggcgagcctgaacccggccggccgcgtctggtcataggccccggcaccgggttgggg
gtcgccgggctgctgccgctggtcggcggcggctggcgcgcgttgccgggcgagggcggg
catatctgtctgccgatcggcagcgagcgcgaggcggcgatctggatgcaactgcaccgc
gcacagggccacgtgaatgccgaagccgtgctcagcgggccgggtttgctgacgctttat
cgtgcctgttgcgcgctggatggccgagcggccgaacacgactccccggccgagatcacc
aaggctgcgctggctggcgagccgtacgccgtggccgtgctggagcagttctgccgctgg
ctgggacgcatcgtcggtgacaacgtgctgacgctcggtgcacgcggcggggtatatatc
gtcggcggcgtggtaccgcgcttcgccgagttcttcatgcacagcggcttttgcgatgcc
ctgtgcgagaagggccaaatgagtggctatttcgatcgcctgccggtatggctggtgacc
gcgccttatccgggcctggaaggcgccggcgtggcgttgcaatcgctgctggagggcgtc
tag

DBGET integrated database retrieval system