KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2515Help
Entry
PSTAB_2515        CDS       T01571                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSTAB_2515
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSTAB_2515
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSTAB_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2716863..2717345)
Genome map
AA seq 160 aa AA seqDB search
MRDPLLDIPCVTIDGEHKTLADFDAKVLLVVNTASQCGFTPQYKGLEELWQRYGERGLVV
LGFPCNQFGGQEPDSEAQIATFCERRFGVSFPLFAKVEVNGGDAHPLFIELKKRAPGLLG
SKAIKWNFTKFLIAGQGRTVRRYSSRTAPQALAADIEALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatcctctgttagatattccctgcgtcaccatcgacggcgagcacaagacgctc
gccgatttcgatgccaaggtgctgctggtggtgaacaccgccagccaatgtggtttcacg
ccccagtacaagggattggaggagctctggcagcgctacggcgagcgtggcctggtcgtg
ctcggttttccgtgcaaccagttcggcggacaggagccggatagcgaggcgcagatcgcc
accttctgcgagcgtcggttcggcgtgtccttcccgttgttcgccaaggtcgaggtcaat
ggcggcgacgcccatccgctgttcatcgagctgaagaagcgcgcgcccggcctgctgggc
agcaaggcgatcaagtggaatttcaccaagttcctcatcgccggtcagggccgcacggtg
cggcgctattcctcgcgtaccgcgccgcaggcgctggcggcggatatcgaggcgctgctc
tga

DBGET integrated database retrieval system