KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2675Help
Entry
PSTAB_2675        CDS       T01571                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAB_2675 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    PSTAB_2675 (dapE)
Enzymes [BR:psz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PSTAB_2675 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2871220..2872368
Genome map
AA seq 382 aa AA seqDB search
MTAPALSPTLELACELINRPSVTPLDEGCQQLMSQRLAACGFAIEPMHIEDVENFWAIRG
NEGPVLCFAGHTDVVPTGPLQAWQNPPFSARIDEQGMLHGRGAADMKGSLAAMVVAVERF
TADHPDHKGQIAFLITSDEEGPAHHGTKAVVERLRERGQRLDWCIVGEPSSTSLVGDVVK
NGRRGSLGGTLTVRGQQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNEFFPPTSFQIS
NLNAGTGATNVIPGTLEAVFNFRFSTESTVEGLQQRTAAILDKHGLDWNVDWALSGLPFL
TEPGALLDGVAKAIRSVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQVDEHI
LASDLDVLTDIYYQTLVNLLAC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccgccctctccccgaccctcgaactggcctgcgagctgatcaaccgcccc
tccgtgacgccgctggacgaaggctgccagcagctgatgagccagcgcctggcggcttgc
ggcttcgccatcgagccgatgcacatcgaggacgtggagaacttctgggccattcgcggc
aacgaaggcccggtgctgtgcttcgccggccatacagacgtggttcccaccggcccgctg
caggcctggcagaacccgccgttcagtgcgcgcatcgacgaacagggcatgctccacggt
cgcggcgcggcagacatgaaaggcagcctggccgccatggtcgtggcagtggaacgcttc
accgccgaccatccggaccacaagggacagatcgccttcctgatcaccagcgatgaggaa
ggcccggcgcaccatggtaccaaggcggtggtcgaacgcctgcgcgagcgcggccagcgc
ctggactggtgcatcgtcggcgaaccctcgagcaccagcctggtgggcgacgtggtgaag
aacggtcgccgcggctcgctgggcggtacgctcaccgttcgcggtcagcagggccatgtg
gcctacccccatctggcgaagaacccgatccacctggccgcgccggcactggccgagctg
gctgccgaacactgggacgatggcaatgagtttttcccgccgaccagcttccagatctcc
aacctgaacgccggcaccggcgccaccaacgtcatccccggcacgctggaagcggtgttc
aacttccgtttctccaccgagtcgacagtcgaaggcttgcagcaacgcaccgcggcgatc
ctcgacaagcacggtctggactggaacgtggactgggcactgtccggcctgccattcctg
accgaaccgggcgcgctgctcgacggcgtggccaaggccatccgcagcgtcaccggccgc
gaaaccacgccgtccaccagcggcggcacctcggacggacgcttcatcgccaccctgggt
acccaggtggtcgagctcggcccggtcaatgccaccatccaccaggtcgacgaacacatc
ctggccagcgatctcgatgtgctgaccgacatctactaccagaccctggtgaacctgctg
gcatgctga

DBGET integrated database retrieval system