KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2935Help
Entry
PSTAB_2935        CDS       T01571                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAB_2935 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAB_2935 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSTAB_2935 (trpB)
Enzymes [BR:psz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSTAB_2935 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3139862..3141073
Genome map
AA seq 403 aa AA seqDB search
MTSYRNGPDAKGLFGHFGGQYVAETLMPLIHELAAEYEKAKADPEFAKELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLAKRMGKQRIIAETGAGM
HGVATASVAARFGMQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVHNTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQMMEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDASVKIIGVEAAGHGIETGQHAASLNGGVPGVLHGNRTFLLQNEDGQI
IDAHSISAGLDYPGIGPEHAWLHDIGRVEYTSITDKEALKAFHTCCRLEGIIPALESSHA
LAEVFKRAPGLPKDHLMVVNLSGRGDKDMQTVMHHYDEQEEHI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacctcataccgcaacggccctgatgccaagggcctgttcggccacttcggtggtcag
tacgtcgccgaaacgctgatgccgctcatccacgagctggccgccgagtacgaaaaagcc
aaggccgaccccgagttcgccaaggagctcgcctacttccagcgcgactacgtgggccgc
ccctcgccgctgtacttcgccgagcgcctgaccgaacactgcggcggcgcgaagatctac
ctcaagcgcgaagagctcaaccacaccggcgcgcacaagatcaacaactgcatcggccag
atcctgctggccaagcgcatgggcaagcagcgcatcatcgccgagaccggcgccggcatg
cacggcgtggccactgcctccgtggccgcgcgcttcggcatgcagtgcgtgatctacatg
ggcaccaccgacatcgaccgccagcaggccaacgtcttccgcatgaagctcctgggcgcc
gaagtgattccggtcaccgccggcaccggcaccctgaaggacgcgatgaacgaagccctg
cgcgactgggtgaccaacgtccacaacaccttctacctgatcggcaccgtcgccgggccg
cacccctaccccgccatggtccgcgacttccaggccgtgatcggcaaggaaacccgcgag
cagatgatggaaaaggaaggtcgcctgcccgactcgctggtggcctgtatcggtggcggc
tccaatgccatgggcctgttccatccgttcctggatgacgccagtgtgaagatcatcggc
gtcgaggcggccgggcacggtatcgagaccggccagcacgcggcgagcctgaacggtggc
gtacccggcgtactgcacggcaaccgcaccttcctcctgcagaacgaggatggccagatc
atcgacgcccactcgatctccgccggcctggactaccccggcatcggcccggaacacgcc
tggctgcacgacatcggccgcgtcgagtacacctcgatcaccgacaaggaagcgctcaag
gctttccacacctgctgccgcctggaaggcatcatcccggcgctggagtcctcccacgcg
ctggctgaagtattcaagcgcgcgcctggtctgccgaaggatcacctgatggtggtcaac
ctctccggccgcggcgacaaggacatgcagaccgtcatgcaccactacgacgaacaggaa
gaacatatatga

DBGET integrated database retrieval system