KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3236Help
Entry
PSTAB_3236        CDS       T01571                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSTAB_3236
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PSTAB_3236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3457203..3458063
Genome map
AA seq 286 aa AA seqDB search
MQMLTLPAPAKLNLMLHITGRRADGYHELQTLFQFLDYGDELVLRPREDGQIRLLTELPG
VDHDSNLIVRAARLLQRESGCALGADIQLTKRLPMGGGIGGGSSDAATTLVGLDHLWNTR
LGEDHLAELGLNLGADVPVFVRGRAAFAEGVGERLQPVDLPEPWFLVIAPQVSVSTAEIF
ADPELTRNTPAITVRSLLAGGGHNDCQPVVEKRYPEVRNALSLLNKFVQARMTGTGACVF
GSFPNEGEADKVRRQLPATLPSFVARGRNVSMLHRSLERMAQEASA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgctgaccctgccggcgccggccaagctcaatctgatgctgcacatcacaggg
cgtcgtgccgatggctatcacgagctgcagaccctgttccagttcctcgattacggtgac
gaactggtcttgcgtccgcgagaggacgggcagatccgcctgctcaccgaattgccaggc
gtcgaccacgacagcaacctgatcgtccgtgccgcacgcctgctgcagcgcgaaagcggc
tgtgcgctgggcgccgacatccagctgaccaagcgcctgcccatgggcggcggaatcggc
ggcggcagctcggatgccgccaccaccctggtcggcctcgaccatctgtggaataccaga
cttggcgaagatcacctggccgaactgggcctgaacctcggggccgatgtaccggtgttc
gttcgcggtcgcgcggccttcgccgaaggggtcggagagcgcctgcaaccagtcgatctc
cccgagccctggttcctcgtcatagcgccgcaagtctctgttagtacagcggaaatattt
gccgacccggagttgacacgtaataccccggccattacagttcgcagccttcttgcaggg
ggcggtcataacgactgtcagccggtggtcgagaagcgttatcccgaagttcgtaacgct
ttgagcttgttgaacaaattcgttcaggcaaggatgaccggcactggagcttgtgtgttt
gggagcttcccaaacgagggcgaggctgataaagtccgccgccaacttccagccactttg
ccgagtttcgtggcccgcggccgcaacgtctcgatgttgcaccgaagcctggaacggatg
gcacaggaagcgagtgcgtag

DBGET integrated database retrieval system