KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3342Help
Entry
PSTAB_3342        CDS       T01571                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3577257..3577784
Genome map
AA seq 175 aa AA seqDB search
MERVYIGLGSNLADPQQQLRGALQALAELPGSRLAAVSSLYASDPLGPADQPRYVNAVAA
LETDLEPLALLDALQRIELAQGRERKAERWGPRTLDLDILLFGERLIDQPRLQVPHYHMQ
ARAFVLYPLAEIAPPELVLADGRRLVDLLAACPFRGLERLVNTSVTDAVTNVTRR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgtctacatcggcctgggcagcaacctggccgatccccagcagcagctgcgt
ggtgctctgcaggcgctggccgaactgccagggagcaggctggctgcggtctcctctctc
tatgccagcgacccgctcgggcccgccgaccagccacgctacgtcaacgcggttgcggca
ctggagaccgacctcgagccgctggcgctgctcgatgccctgcagcgcatcgaactggcg
cagggccgcgaacgcaaggccgaacgctggggcccgcgcaccctggacctggatatcctg
ctgttcggcgagcgactgatcgaccagccgcgcctccaggttccgcactatcacatgcag
gctcgggcgttcgtgctctacccgctggccgagatcgctccgccggagctggtgctggcc
gatgggcgacggctcgtcgacctgctcgcggcctgcccgttccgcgggctggagcggctc
gtcaatacgagtgtcaccgacgcggtaacgaacgtaacgcgcaggtaa

DBGET integrated database retrieval system