KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3361Help
Entry
PSTAB_3361        CDS       T01571                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSTAB_3361 (tpiA)
   01230 Biosynthesis of amino acids
    PSTAB_3361 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_3361 (tpiA)
   00051 Fructose and mannose metabolism
    PSTAB_3361 (tpiA)
   00562 Inositol phosphate metabolism
    PSTAB_3361 (tpiA)
Enzymes [BR:psz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSTAB_3361 (tpiA)
Exosome [BR:psz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSTAB_3361 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSTAB_3361 (tpiA)
  Exosomal proteins of melanoma cells
   PSTAB_3361 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3597812..3598534)
Genome map
AA seq 240 aa AA seqDB search
MNGTRASVAELIESFQRQALPAAVEIAVFPSFVHVSQVLDVVDGAQVSVGAQDCALQSGF
GALTGEVSADQLVDLGCEWVLVGHSERRLVLGETDEVVSQKFAAAQAGGLKPVLCLGETL
EEREAGRTLEVVARQLGRVLDDQGVEAFQSAVIAYEPVWAIGSGLTATPEQAQEVHAAIR
DQLARSDRRVAEGVRLLYGGSVKADNAAELFAMADIDGGLVGGASLKADEFGAICRAAGN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtacccgcgctagcgtcgcagagctgatcgagtcttttcagcgtcaggcactg
cctgcagcggttgagattgcggtgtttccctcctttgtgcatgtcagtcaggtcctggat
gttgtcgatggggcgcaagtttccgtcggtgctcaggattgtgccttgcagtcgggtttc
ggggcgctgactggcgaggtttcggccgaccagttggttgatctcggttgtgagtgggta
ttggttgggcactctgagcgccgcctggtattgggtgagacggacgaggtggtcagccag
aaatttgcggcagctcaggcgggcggtttgaagcctgtgctgtgcctcggtgagacgctc
gaggagcgcgaggctggaagaacgctggaagtggtggcgcggcagttggggcgggttctc
gatgatcaaggtgtcgaggcgttccagtctgcagtgattgcgtatgagcccgtctgggcc
atcgggtctggcttgacggctacgcctgagcaggcgcaagaggtgcatgccgccattcgc
gatcaactggcacgcagcgatcgtcgcgtcgccgaaggtgtaaggctgctgtatggtggc
agcgtgaaggcggacaatgccgctgagctgttcgccatggcggatattgatggggggctg
gttggtggagcctctctgaaagcggatgaattcggtgcgatctgtcgcgccgcggggaac
tga

DBGET integrated database retrieval system