KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3532Help
Entry
PSTAB_3532        CDS       T01571                                 

Definition
two-component hybrid sensor and regulator
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:psz02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:psz02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3798596..3802762
Genome map
AA seq 1388 aa AA seqDB search
MSTSPEPSVPKNSNLTRSTLQFPVVGIGASAGGLKALMTLFEHMPKDCGMAFVVIMHLSP
KHESKADQILQKATRMPVLQVTQPTPIERNHIYVIPPALDLSMNDGYLRLTEPQRERGVQ
VAIDLFFRTLADTHHTHAIGIVLSGSGADGSVGLSRIKEQGGITLAQEPGDAEFESMPRS
AIETGMVDIVLPVADIAQKLVELRRNMQTLLEQFRPVPAPEDGEHPAVEPGEMYYIQAQP
QSKPNELALREILAALRTRTGHDFRHYKLATVLRRIERRMQVNALPDMPSYARYLQGNPE
ETPALLADMLIGVTNFFRDREAFEALERDIIPVLFEQKLATDDRALRVWAAACSTGEEAY
SLAMLLTDQAAHSGVDIQTQLFATDIDDRALETARAGVYPEAIVTDVTPARLRQYFVKDQ
NQLRLQKELRERILFARPNILRDPPFSRLDLISCRNLMIYLDRDIQIEVLRMFHFALNPG
GYLFLGSSETADVCSQLFTAVDKKNRIYRAKEVGSSLRRAPLGPVHGFTLSTPPRPPFSE
PHRRHRKFSFADVHQRALEQYAPPSVIVNQEAEIVHMSDRAGNFLRYVGGEPSLNLTTLV
HPQLRLELRTALYQAAHTGKSVEARRVRLERDGRSYYVNMVVRPFRDNEAGSDYMLVLFD
EVEAFMDSSTLEDPDTKDSVLTQLEAELQHTKERLQITMEHSETSTEELRASNEELQAIN
EELRSATEELETSKEELQSINEELTTVNYELKSKVDETSKINDDLQNLISSTDIATVFVD
RKMRIKWFTPRARDIFNVIGNDAGRSLFDITHRLDYPLLAKDAAEAFEELHLVEREVRDR
EGQHWYLARFLPYRTLDDRIEGAVLTFIDITDRRRAEEELRAGEAHLKLLAQSTKGYAII
TLDCDGLITTWNCGAELILGYRETEVLGQTVDIIYTEQDRQAGVPEAERQRALQHGQATD
ERWHARRDGSRCFLSGLLNPLVDGTGKVIGFAKIARDLTEERQRSSEQQNELESVQAANL
QKDQFFAVLSHELKHPLNLIQLNTDLVARSQAVKNNPSLHKATQSIQNAVRSQSRIIDDL
MDVSRIRTGKLKLHFATLRYQDVLRGIEAVFAPLAQSENISFESFKPDAPIYIQADPTRL
DQIIWNLLNNAWKFSKGGERICMQLEREGGQARLDVIDTGEGISADFLPKVFDMFGQAEM
QHAQRAKHGLGIGLALVKQLVEAHNGRIEAYSEGIGRGARFSVWLPVHLQTEFELSDLAN
ADAAGGLRGIRILLVDDSPDILETMCELLQSEGAEVTTADGGARAIELAEQTPFDVIVSD
IGMPEIDGHKMMAIIRQQGANRDTPSIALTGYGTLRDVEKAMAAGFTLHLRKPIDLQALI
DAVSQAVH
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccagccctgagccgtccgtgccgaagaacagcaacctgacccgcagcacgctg
cagtttcccgtggtcggtatcggcgcctcggcaggcggactcaaggcgctgatgacgctg
ttcgaacacatgccgaaagattgcggcatggccttcgtggtgatcatgcacctctcgccc
aaacacgagagcaaggccgaccagatcctgcagaaggcgacccgcatgccggtgctgcag
gtcacccagccgacgcccatcgagcgtaaccacatctacgtgattcccccggcgctggac
ctgtcgatgaacgacggctacctgcgcctgaccgagccgcagcgcgagcgcggcgtgcag
gtggccatcgacctgttcttccgcacgctggccgacacccaccacacccacgccatcggc
atcgtgctttccggcagcggtgccgacggttcggtggggctgtcgcgcatcaaggaacag
ggcggcatcaccctggcgcaggaacccggcgatgcggagttcgagtcgatgccgcgcagc
gctatcgaaaccggcatggtcgacatcgttctgccggtggccgacatcgcgcagaagctg
gtcgaactgcgccgcaacatgcagacgctgctcgagcagttccgcccggtgccggcgccc
gaggacggcgagcaccccgcggtcgagccgggcgagatgtactacatccaggcgcaaccc
cagtccaagcccaacgagctggcgctgcgcgagatcctcgccgcgctgcgcacccgcacc
ggccacgatttccgccattacaagctggccacggtgctgcgccgcatcgaacggcgcatg
caggtcaatgccctgcccgacatgcccagctatgcccggtacctgcagggcaacccggag
gaaaccccggcactgctggccgacatgctgatcggcgtgaccaacttcttccgcgaccgc
gaggccttcgaggcgctggaacgcgacatcatccccgtgctgttcgagcagaagctcgcc
accgatgaccgcgctctgcgtgtctgggccgcggcctgctccaccggcgaggaagcctat
tcgctggccatgctgctcaccgaccaggccgcccacagcggggtcgacatccagacccag
ctgttcgccaccgacatcgacgatcgcgccctggaaaccgcgcgcgccggcgtctacccc
gaggccatcgtcaccgacgtcaccccggcccgactgcgccagtacttcgtcaaggatcag
aaccagctgcgcctgcagaaggagctgcgcgagcgaatcctcttcgcccgtcccaacatc
ctgcgcgacccgccattctcgcggctcgacctgatctcctgccgcaacctgatgatctac
ctggaccgcgacatccagatcgaagtgctgcgcatgttccacttcgccctcaaccccggt
ggctacctgtttctcggcagctccgaaaccgccgacgtctgcagccagctgttcaccgcg
gtggacaagaagaaccgcatctaccgcgccaaggaagtgggctcctcgctgcgccgcgcg
cccctcggcccggtgcacggcttcaccctcagcacgccgccgcgcccgccgttcagcgag
ccgcaccggcgccaccgcaagttctccttcgccgacgtgcaccagcgcgcgctcgagcag
tacgcgccgcccagcgtcatcgtcaaccaggaggcggagatcgtgcacatgtccgaccgc
gccgggaacttcctgcgctatgtcggcggcgagccctcactgaacctgaccaccctggtg
catccccaattgcgcctcgaactgcgcaccgcgctgtaccaggccgcccataccggcaag
agcgtggaggcacggcgcgtgcgtctggaacgcgacggccgcagctactacgtgaacatg
gtggtgcgcccgttccgcgacaacgaggcaggcagcgactacatgctggtgctgttcgac
gaagtggaagccttcatggacagcagcacgctggaggatccggacaccaaggacagcgtc
ctgacccagctcgaggcggaactgcagcacaccaaggagcgcctgcagatcaccatggag
cactcggaaacctccaccgaggaactgcgcgcctccaacgaggagctgcaggcgatcaac
gaggaattgcgctcggccaccgaggagctggaaaccagcaaggaagagctgcagtcgatc
aacgaagagctcaccaccgtcaactacgagctcaagagcaaggtcgacgagaccagcaag
atcaacgacgacctgcagaacctgatctcctccactgacatcgccacggtcttcgtcgac
cgcaagatgcgcatcaagtggttcaccccgcgtgccagggacatcttcaacgtgatcggc
aacgatgccggccgctcgctgttcgacatcacccaccgcctggactacccgctgctggcc
aaggacgccgccgaagccttcgaagagctgcacctggtcgagcgcgaggtgcgcgaccgc
gagggccagcactggtacctggcgcgcttccttccctatcgcacgctggacgaccgcatc
gaaggcgccgtgctgaccttcatcgacatcaccgaccgccgccgggccgaggaagagcta
cgcgccggcgaagcccacctcaagctgctggcgcagagcaccaagggctacgccatcatc
accctggactgtgacggcctgatcactacctggaactgcggtgccgagctgatcctgggt
taccgcgaaaccgaagtgctcggccagacggtggacatcatctacaccgagcaggatcgc
caggccggtgttccggaagccgaacgccagcgcgcactgcaacatgggcaggccacggac
gagcgctggcacgcccgccgcgatggcagtcggtgcttcctcagcggcctgctcaatcca
ctggtggatggtacgggcaaggtcatcggcttcgccaagatcgcccgcgacctcaccgag
gaacgccagcgcagctccgaacagcagaacgaactggagagtgtgcaggcggccaacctg
cagaaggaccagttcttcgccgtactctcccacgagctgaagcacccgttgaacctcatc
cagctcaacaccgacctggtcgcccgctctcaggcggtgaagaacaacccgagcctgcac
aaggcgacgcagtcgatccagaacgcggtgcgcagccagtcgcggatcatcgacgacctg
atggatgtctcgcgtatccgcaccggcaagctcaagctgcacttcgccacgctgcgctat
caggacgtgctgcgcggcatcgaagcggtgttcgcgccgctggcacagagcgagaacatc
agcttcgagagcttcaagccggacgcccccatctacatccaggccgacccgacgcgcctg
gaccagatcatctggaaccttctgaacaacgcctggaagttctccaagggtggcgaacgc
atctgcatgcaactcgagcgcgagggcggccaggcccggctcgacgtcatcgacaccggc
gaaggcatcagcgccgacttcctgcccaaggtcttcgacatgttcgggcaggccgagatg
cagcatgcgcagcgtgccaagcacgggctgggcatcggcctggcgctggtcaagcagctg
gtcgaggcgcacaacgggcgcatcgaggcctattcggaaggcatcggccgcggcgcgcgc
ttcagcgtctggctgccggtgcacctgcagaccgaattcgaactcagcgacctggccaat
gccgatgccgccggtgggctcaggggcatccgcatcctgctggtggacgactcgccggac
atccttgaaaccatgtgcgagctgctgcaaagcgagggcgccgaggtcaccactgccgac
ggcggtgcgcgggccatcgagctggccgagcagacgccgttcgatgtgatcgtctccgac
atcggcatgccggagatcgacggccacaagatgatggccatcatccgccagcagggcgcc
aatcgggacaccccgagcatcgccctgaccggctacggcaccttgcgcgacgtggaaaag
gccatggccgcgggcttcaccctgcacctgcgcaaacccatcgacctgcaggcgctgatc
gacgcggtgagccaggcggtgcactga

DBGET integrated database retrieval system