KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3804Help
Entry
PSTAB_3804        CDS       T01571                                 

Gene name
aceB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00010  Glycolysis / Gluconeogenesis
psz00020  Citrate cycle (TCA cycle)
psz00620  Pyruvate metabolism
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01200  Carbon metabolism
Module
psz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_3804 (aceB)
   00020 Citrate cycle (TCA cycle)
    PSTAB_3804 (aceB)
   00620 Pyruvate metabolism
    PSTAB_3804 (aceB)
Enzymes [BR:psz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSTAB_3804 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: AEJ07085
UniProt: F8H361
Position
4100138..4102144
Genome map
AA seq 668 aa AA seqDB search
MSETIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEIPAPKAGVVKSLKVK
LGDRLKEGDELLELESEEGQDSAAPAQAAAEPAGAATGGPTDEAEAPTPPGDDDASASAG
EGETQEIKVPDIGSSGKASVIEIAVKAGDTIAAEQALITLESDKASMEIPSPAAGVIESI
SVKVGDEVGTGDLILILKGAASSKPAAGKAPASQAASAPKQKLSEPAAEEPAEAAGESVE
EVRIPDIGSSGSANVIEVMVKAGDSVEADQSLITLESDKASMEIPAPKAGVVESLSIKVG
DEAKTGDLILTLKVQGTAPAKKPAPKADEAAPQQQAVAPNKQGVPEAKAAATPAPAVSGP
SKAGTKVHAGPAVRMLAREFGVELTDVPATGPKGRILKEDVQAYVKNMLHKVKQAPAEGT
TGGAGIPPIPTIDFSKFGEVEEVPMTRLMQVGAANLHRSWLNVPHVTQFESADITELEAF
RVAQKAIAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKALIRKKYVHVGFAVDT
PDGLMVPVIRNVDQKSLLQLAGEAAELAEKARTKKLSPDAMQGACFTISSLGHIGGTGFT
PIVNAPEVAILGVSKAAMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLSELL
ADIRTMLL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaaccatacgcgtacccgacatcggcagtggtgagggtgaagtaatcgaattg
ttcgtcaaggtcggcgaccgtatcgaagccgaccagagcatcctgacgctcgagtccgac
aaggccagcatggaaattccagcgcccaaggcgggcgtggtgaagagcctgaaggtcaag
ctcggcgatcgtctgaaagaaggcgacgagctgctggagctggaaagcgaagaaggccag
gacagtgcggctccggcacaggctgcagccgaacccgctggcgcagcgaccggcggcccg
acagatgaagccgaagcgccgacgcctccgggcgacgacgatgcttcggcctcggccggc
gaaggcgagacacaggagatcaaggttcctgatatcggctcctcgggcaaagccagcgta
atcgaaattgcggtcaaagccggcgataccattgccgccgaacaagcgttgatcacgctc
gagtcggacaaggccagcatggagattccgtctcctgccgccggcgtgatcgagagcatt
tcggtcaaggtgggcgacgaagtcggcaccggcgatctgatcctgattctcaaaggcgca
gcgtccagcaagccagcagcaggcaaggcgccagcgagccaggccgcaagcgctccgaag
caaaagctcagcgagccggcagctgaagagcctgccgaagccgccggcgaatccgtggaa
gaagtgcgtatcccggacatcggctccagcggcagcgccaatgtcatcgaagtgatggtc
aaggccggggacagcgtcgaggcggatcagtcgctgattacccttgagtccgacaaggcc
agcatggaaattcctgcgcccaaggcgggcgtggtggaatcgctgtcgatcaaggtcggt
gacgaggccaagaccggcgatctgatcctgaccctaaaggtccaaggcaccgcaccggcg
aagaaacccgctcccaaggcggatgaggctgcgccgcagcagcaggccgtcgcaccaaac
aagcaaggcgttcccgaggcgaaggctgccgcgacgccggctccggcggtcagcggcccg
agcaaggctggcaccaaggtgcacgcggggccggcggtacgcatgcttgcacgcgaattt
ggcgtagaactgactgatgttccggccactggcccgaagggacgcatcctcaaggaagac
gtccaggcctacgtcaagaacatgctgcacaaggtcaagcaggctcctgccgaaggtact
accggcggggcgggtattccgccgatcccgacgatcgacttcagcaagttcggtgaagtc
gaagaagtgccgatgacccgcctgatgcaggtcggtgccgccaacctgcatcgcagctgg
ctgaacgtaccgcacgtgacccagttcgagtcggccgacattaccgagctggaagctttc
cgcgttgcgcagaaggcgatcgccgagaaggctggggtcaagctcaccgtgctgccgcta
ttgctcaaggcgtgcgcgcacctgctaaaggaactgccggatttcaacagttccctggcc
ccgagcggcaaggcgctgatccgcaagaagtatgtgcacgtagggttcgccgtcgacacg
ccggatggcctgatggtcccggtgattcgcaacgtcgaccagaagagtctgctgcaactg
gccggcgaggctgcggagctggctgagaaggcccgcaccaagaagctttctccggatgcg
atgcagggcgcctgcttcacgatctccagcctcggccacatcggcggcaccggcttcacg
ccgatcgtcaatgcgccggaagtggcgatcctaggcgtctccaaggcggccatgcagccg
gtgtgggatggcaaggccttccagccccgcctgatgctgccgctgtcgctctcctacgac
caccgggtgatcaacggtgccgcagcggcgcgcttcaccaagcgcctgtcggagctgctg
gccgatatccgcaccatgctgctgtaa

DBGET integrated database retrieval system