KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3856Help
Entry
PSTAB_3856        CDS       T01571                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00620  Pyruvate metabolism
psz00630  Glyoxylate and dicarboxylate metabolism
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTAB_3856
   00630 Glyoxylate and dicarboxylate metabolism
    PSTAB_3856
Enzymes [BR:psz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSTAB_3856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEJ07137
UniProt: F8H402
Position
4160748..4162928
Genome map
AA seq 726 aa AA seqDB search
MTERVQVGGLQVAKVLYDFVNNEAIPGTGVDAAAFWAGADSVIHDLAPKNRALLAKRDEL
QAKIDAWHQARAGQAHDAVAYKAFLQEIGYLLPEAEDFQATTENVDEEIARMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEADGATKGPGYNEIRGNKVIAYARNFLNEAA
PLETGSHVDSTGYRIEGGKLVVSLKDGSTTGLKNPAQLQGFQGEASAPIAVLLKNNGIHF
EIQIDPASPIGQTDAAGVKDILMESALTTIMDCEDSIAAVDADDKTIVYRNWLGLMKGDL
VEELDKGGKRITRAMNPDRVYTKADGNGELTLHGRSLLFIRNVGHLMTNDAILDKAGNEV
PEGIMDGLFTSLIAIHNLKGNTTRANSRTGSMYIVKPKMHGPEEVAFATELFGRVEDVLG
LPRNTLKVGIMDEERRTTINLKACIKEARERVVFINTGFLDRTGDEIHTSMEAGPMVRKA
AMKAEKWIGAYENNNVDVGLACGLQGKAQIGKGMWAMPDLMAAMLEQKVGHPMAGANTAW
VPSPTAATLHAMHYHKIDVQARQVELAKREKASIDDILTIPLAQDTNWSEEEKQNELDNN
SQGILGYMVRWVEQGVGCSKVPDINDIALMEDRATLRISSQHVANWMRHGVVTKDQVIES
LKRMAPVVDRQNQGDPLYRPMAPDFDNSVAFQAALELVLEGTKQPNGYTEPVLHRRRREF
KAKNGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgttcaagtcggtggcctgcaggtcgccaaagtcctgtacgacttcgtg
aacaacgaagcgattcccggtaccggcgtcgatgccgctgccttctgggccggcgccgac
agcgtcatccacgacctggcgccgaagaaccgcgccctgctggccaagcgcgacgagctg
caggccaagatcgacgcctggcaccaggcccgcgccggccaagcccatgacgccgtggcg
tacaaggccttccttcaggaaatcggctacctgctgccggaagccgaagacttccaggcc
accaccgagaacgtcgacgaagaaatcgcccgcatggccggcccgcagctggtggtgccg
atcatgaacgcgcgcttcgccctgaacgccgccaacgcccgctggggctcgctgtatgac
gcgctctacggcaccgacgccatctccgaagcggacggcgccaccaaggggccgggctac
aacgagatccgcggcaacaaggtcatcgcctatgcgcgcaatttcctcaacgaagctgca
ccgctggaaaccggctcgcacgtcgattccaccggctaccgcatcgaaggcggcaagctg
gtcgtttcgctcaaagacggcagcaccaccggcctgaagaacccggcccagctgcaaggc
ttccagggcgaagccagcgcaccgatcgctgtgctgctgaagaacaacggcattcacttc
gagatccagatcgacccggccagcccgatcggccagaccgacgcggccggcgtgaaggac
atcctgatggaatcggcgctgaccaccatcatggactgcgaagactccatcgccgccgtc
gacgccgacgacaagaccatcgtctaccgcaactggctcggcctgatgaagggcgatctg
gtcgaggagctggacaagggcggcaagcgcatcacccgcgccatgaacccggaccgcgtc
tacaccaaggccgacggcaacggcgagctgaccctgcacggacgctcgctgctgttcatc
cgcaacgtcggtcacctgatgaccaacgacgccatcctcgacaaggcaggcaacgaagtg
ccggaaggcatcatggacggcctgttcaccagcctgatcgccatccacaacctcaagggc
aacaccacccgcgccaacagccgcaccggctcgatgtacatcgtcaagccgaagatgcac
ggcccggaagaagtcgccttcgccaccgagctgtttggccgcgtcgaggacgttctcggc
ctgccgcgcaacaccctcaaggtgggcatcatggacgaggagcgtcgtaccacgatcaac
ctcaaggcctgcatcaaggaagcgcgcgagcgtgtggtgttcatcaacaccggcttcctc
gaccgcaccggtgacgaaatccacacctccatggaagccggcccgatggtgcgcaaggcg
gccatgaaggccgagaagtggatcggcgcctacgagaacaacaacgtcgacgtgggtctg
gcgtgcggtctgcagggcaaggcgcagatcggcaagggcatgtgggccatgcctgacctg
atggccgccatgctcgagcagaaggtcggccaccccatggccggtgccaacaccgcgtgg
gtaccgtcgccaaccgcagccaccctgcacgccatgcactaccacaagatcgacgtgcag
gcgcgtcaggtcgaactggccaagcgcgaaaaagcttccatcgacgacatcctcaccatc
ccgctggcgcaagacaccaactggagcgaggaagagaaacagaacgagctggacaacaac
tcgcagggcatcctcggctacatggtgcgctgggtcgaacagggcgttggttgctccaag
gtgccggacatcaacgacatcgcgctgatggaagaccgtgccaccctgcgcatctccagc
cagcacgtggccaactggatgcgccacggcgtggtaaccaaggaccaggtgatcgagagc
ctcaagcgcatggccccggtggtcgaccgccagaaccagggtgacccgctgtaccgcccg
atggcgcctgacttcgacaacagcgtggccttccaggctgcgctggagctggtcctcgaa
ggcaccaagcagcccaacggctacaccgagccggtcctgcaccgtcgccgtcgcgagttc
aaggccaagaacggcctgtaa

DBGET integrated database retrieval system