KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3993Help
Entry
PSTAB_3993        CDS       T01571                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSTAB_3993 (recD)
Enzymes [BR:psz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PSTAB_3993 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4312111..4313961)
Genome map
AA seq 616 aa AA seqDB search
MTLADLPLGPLERAFVASLQRLEPQAPEAVLLAATLCCEALAAGDVCLPLERLAGRRPWP
DVDLSMPALPVWHAQLEASTLVGTPDDYAPLTLVGDRLYLARYQAYEQQLAEQLLARTGD
APEVDEARLAESLARLFAFNQQRPDWQRLAAAQAVRRRLAVISGGPGTGKTTTVVRLLAA
LLEQPGGERLAIGLAAPTGKAAARMAEAIRNAKAELPVSDAVKEALPDEARTLHRLLGSR
GDSPRVRHDAANPLALDVLVVDEASMVDLALMAKLVVALPPKARLILLGDKDQLAAVEAG
AVFAELCEGRGFDAGAASELERITGQPVPVETPRSRLGDAVVLLTHSHRFAGDSGIGELA
RRINAGDAKGTVALLQEGRADLAWNATPGATALIERLEQGYGGYLQAARQGDPGPAFEAF
NGFRALTAQREGPFGVTGINEALETRFRRRLGVPARERWYPGRAVMVRQNDYALGLFNGD
IGLCLKTEQGLRVFFEGDNGYRGFAPARLPSHDSAFAMTVHKSQGSEFTEVLLALPDQPS
PLLTRALFYTGITRAKRRVEIWALPARLAEAVSTRAERAAGLAERLVLAGAVADADAVPE
APIGAAPAEGDQLSLF
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgccgatctgcccctcggcccgctggagcgcgcctttgtcgccagcctgcaa
cgcctggaaccgcaggcgcccgaagcggtgctactcgccgccacgctgtgctgcgaggcg
ctggcggccggcgatgtctgtcttccactggaacgcctggccggaaggcgcccctggccc
gatgtcgatctcagcatgccggcgctgcccgtctggcacgcacagctcgaagcttccacg
ctggtcgggacaccggacgactatgcgccgctgaccctggtcggcgaccggctctacctg
gcccgctaccaggcctacgaacagcagctggccgaacagctgctggcccgcaccggcgat
gcgcccgaggtggacgaagcacggctcgccgagagcctggcgcgcttgttcgccttcaat
cagcagcgccccgactggcagcgcctggccgccgcccaggcagttcggcgtcggctggcc
gtaatctccggcggtcccggcaccggcaagaccaccaccgtggtgcgcctgctggcggcg
ctgctcgagcagcccggcggcgagcgcctggccatcggcctcgctgcacccaccggcaag
gccgcggcacgcatggccgaggcgatccgcaacgccaaggccgagctgccggtcagcgat
gcggtgaaggaggccctgccggacgaggcgcggaccctgcaccgcctgctcggcagccgc
ggcgacagcccccgagtgcgccacgatgcggccaatccgctggcgttggacgtgctggtg
gtggacgaggcgtcgatggtcgacctggcgctgatggccaaactggtcgtcgcgctgcca
ccgaaggcgcggctgatcctgctcggcgacaaggatcagctggccgccgtggaggccggt
gcggtgttcgccgaactctgcgaaggccgtggcttcgatgccggggcggcaagcgagctg
gagcgcatcaccggccagcccgtgccggtcgagacgccgcgctcgcgcctcggcgatgcg
gtggtgctgctcacccacagtcaccgcttcgccggcgacagcggcatcggcgagctggcg
cggcggatcaacgctggcgatgcgaaaggcaccgtcgcgctgctgcaggaaggtcgtgcg
gatctcgcctggaacgcgacgcccggcgcgaccgccttgatcgagcggctggagcagggt
tacggcggttacctgcaggctgcgcggcagggcgatccaggcccggcgttcgaggccttc
aacggtttccgggcgctgactgcgcaacgcgagggcccgttcggcgtgaccggtatcaac
gaggcgctggaaacacgcttcaggcgtcgcctcggcgtgccggcccgcgaacgctggtat
cccggccgtgcggtgatggtccggcagaacgactacgcgctggggctgttcaacggcgat
atcggcctgtgcctgaaaaccgagcagggcctgcgggtgttcttcgagggtgacaacggt
taccgcggcttcgcgccggcacggctgccgagccacgacagcgccttcgccatgaccgtg
cacaagagccagggctcggaattcaccgaggtgctgctggccttgccggatcagccgagc
ccgctgctgacgcgcgcgctgttctacaccggcataacccgcgccaagcgccgggtggag
atctgggcgctgccggcgcggctggctgaagcggtcagcacccgcgccgagcgcgccgcc
gggctggccgagcggctggttctggcgggcgccgtggccgatgccgatgcggtgccggaa
gccccgatcggtgcggcgccagccgagggcgatcagctcagcctgttctaa

DBGET integrated database retrieval system