KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4005Help
Entry
PSTAB_4005        CDS       T01571                                 

Definition
response regulator
Organism
psz  Pseudomonas stutzeri ATCC 17588
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4331450..4333375)
Genome map
AA seq 641 aa AA seqDB search
MTRLLLLLLACLLLSPTVAATAAGSAAVQTRGASTLQLGALEYVLGMPAADFDAAASDAW
PWQPLARPTLGKQPDGAWLRLFLRNGGTDARLWYLLLKWPVLDRVAVRLHYPDSGRWGAP
MLAGDALALSARPLADHHFVYPLELPPGERAVVYLQVQARETLALPLELIDEKQFVEGRL
RDVTLVSLFFGGILVIVLYNLSLLVFTRDGSYFFYVLYLLSAVFYVLSITGFGQLYLWPE
IPELSARFYGLSAALCFFTPMLFALRFLGVRRYGGWVWWVSITLTLYWGAAVLVLLLVPT
LGRYLFMESVALPHCGLTMAVTLNLWARGNPSARLFSIAWSALLIFTVVNLLALNGVLPL
NAWTLNGQLIGMFTEFVLLSMALAERINIERNRRIAAQQLALETSESLAAERALHLQAKQ
EALDLQLQANEVLEARVYERTRALEEARQGLETANAELLRLSATDALTQLANRRRFDSVL
DEEIRRARRSGSPLAVLLADIDHFKRINDSYGHPFGDECLRQVAAVLMAHCQRAGDLAAR
YGGEEFVVLLPASDQRQAVVLAERIRQDIECLQLRHGDLPVALTISLGVATLGSTCVSAE
ALLAAADAALYAAKHAGRNRVVCAPEAAIGETGPGVSPQPV
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtctgctcctgctgctgttggcctgcctgctgctgtcgcctacggtggccgcc
accgcggccggctcggcggcggtccagacacgcggcgcctcgaccctgcagctcggcgcc
ctggagtacgtgctcggcatgcccgcggcggacttcgacgcagcggccagcgacgcctgg
ccatggcaaccgctggcgcgtccgacgctgggcaagcagcccgacggtgcctggctgcgc
ctgttcttgcgcaacggcgggacggatgcgcggctctggtacctgttgctgaagtggccg
gtgctcgaccgggtcgcggtgcgcctgcactacccggacagcggtcgctggggtgccccg
atgctggcaggcgacgccctggcgctgagcgctcggccgctggccgaccatcatttcgtc
tacccactcgagctgccgccgggcgagcgggcggtggtctatctgcaggtgcaggcccgc
gaaaccctggcgttgccgctggagctgatcgacgagaagcagttcgtcgagggccgcctg
cgggacgtcaccctggtcagcctgttcttcggcggcatcctggtgatcgtgctgtacaac
ctgagcctgctggtcttcacccgtgacggcagctacttcttctacgtgctctatctgctc
agtgcggtgttctacgtgctgagcatcaccggcttcggccagctctatctctggccggaa
atacccgagctgtcggcgcgcttctacggactgtccgccgcgctgtgcttcttcacaccg
atgctgttcgccctgcgctttctcggcgtgcgccgctacggcggctgggtgtggtgggtg
tccatcacgctgacgctgtactggggcgcggcggtgctggttctgctgctggtgccgacg
ttggggcgctacctgttcatggaaagcgtcgcgctgccgcattgcgggctgaccatggcg
gtaacgctcaacctctgggcgcgtggcaatccgtcggcgcggctgttcagcatcgcctgg
agcgcgctgctgatcttcaccgtggtcaacctgctggccctcaatggcgtgctgccgctc
aacgcctggaccttgaacggccagctgatcggcatgttcaccgagttcgtgctgctctcc
atggcgctggccgagcgcatcaacatcgagcgcaaccggcgtatcgcggcgcagcagctg
gccctggagacctccgagtcgctcgccgccgagcgcgccctgcacctgcaggccaagcag
gaggcgctggacctgcagctgcaggccaacgaggtgctggaggcgcgggtctacgagcgc
acccgcgcgctggaagaagccaggcagggactggagaccgccaatgccgaactgctgcgc
ctgagcgccaccgacgcgctgacccagctggccaaccgccggcgcttcgacagcgtgctg
gacgaggagattcgccgtgcccgccgcagcggcagcccgctggcagtgctgctggccgac
atcgatcacttcaagcgcatcaacgacagctatggccatccgttcggtgacgagtgcctg
cgccaggtggcggcggtgctcatggcgcattgccagcgtgccggtgacctggcggcacgc
tatggcggcgaggagttcgtcgtgctgctgccggcatccgatcagcgccaggcggttgtg
ctggcggagcggatccgccaggacatcgagtgcctgcagctgcgccacggcgacctgccg
gtggcgttgaccatcagccttggcgtcgccacgctggggtcgacctgtgtctcggcagag
gcgctgctggccgctgcggatgcggcgctgtatgccgccaagcacgccggtcgcaaccgg
gtggtctgtgcgcccgaggcggcgatcggcgaaaccggccccggcgtcagccctcagccg
gtatga

DBGET integrated database retrieval system