KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4022Help
Entry
PSTAB_4022        CDS       T01571                                 

Definition
GGDEF domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4348507..4350372)
Genome map
AA seq 621 aa AA seqDB search
MSEEAERWKEKYLQLAERQEQLDARWEQRVDLLRRSLVRSSLAVEGADPAVERCLQQMRE
VLRDGDLDDGLGQLVPRLEKAVLDSERHRQERAVQLTEALHRLVSQLLGMSVPAELRKPL
KRFAKDLDQRAARLRELPLLLGELSVLQGQVLNLQGLSAPQQSGFLKRLFGGRDSQSAAP
LETAIPAAASAPAVAVEAEAVVVGETAVASTVTEPSVVTTLPEPANEEQQAVEPVVSSVE
PEADEPVADAELPPAAEPLPQEAAYALPDSPEPAFSVVAERVEATLSSLLDSLHLPEQHQ
PQLQTLRARIQQGLNWYELVPVLDDLAMLMIAFSDQGQRDFENYLQTLNERLTAMQENLL
AAHQGHVEGRDAAQALDAELREQVGGLQHSMREATDLNSLKRVVEARLDGLLDTVDNYRR
QRSEQEQKLGERLQQLVSRVGSLEQAARGLRGHLEEQRQKALQDPLTGLPNRAAWNERLD
LEFARWQRYGGDLPLAVLDVDHFKRVNDGYGHLAGDRVLKIIGTELQRRLRKTDFIARFG
GEEFVVLLPNTPYEAGRQLIETLRESIGSCPFHFKGERVAITLSAGLTAFVTGDTAERAF
ERADRALYRAKDSGRNRVEPA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaagccgaacgctggaaggaaaagtatcttcagctggccgagcgccaggag
cagctggacgcccgctgggagcagcgcgtcgatctgttgcggcgcagcctggtgcgcagc
agcctggcggtggagggcgccgaccccgccgtcgagcgctgcctgcagcagatgcgcgag
gtcctgcgtgacggggatctggacgatgggctgggtcagctggttccacgcctggaaaag
gcggtgctggactccgaacgccaccgccaggagcgtgccgttcagttgaccgaggcgctg
catcggctggtgtcccagttgctggggatgtcggtgcccgccgagctgcgcaagccgctc
aaacgcttcgccaaggatctggaccagcgtgcagccagattgcgcgagctgccgctactg
ctcggcgagctgagtgtactgcagggtcaggttctcaacctgcagggcttgtccgcgccg
cagcagagcggctttctgaagcgcctgttcggggggcgggacagccaatcggcggccccg
ctcgagacggcgattccagcggcggcgtcggccccagcggtggcggtcgaggcagaggcg
gtcgtcgtcggcgagacggccgtcgcctccaccgtgaccgagccgtctgtagtgacaacc
ttaccggagccggcgaacgaagagcagcaggccgtcgagcctgtcgtctcgtcagttgag
cccgaagcggacgagccggtggcggacgccgagctgccgccagcggccgagccgctgccg
caggaggccgcctatgcgctgccggattcgccggagcccgctttcagcgttgtcgccgaa
cgtgtggaggcgacgctcagcagtctgctcgacagcctgcatctgcccgagcagcatcaa
ccgcaactgcagacgttgcgcgcgcgaatccagcagggcctgaactggtacgagctggtg
ccagtgctggacgatctggcgatgctgatgatcgccttcagcgatcagggtcagcgcgat
ttcgagaactacctgcagactctcaacgagcgtctgacagcgatgcaggagaacctgctc
gccgcccaccagggccatgtggaaggccgcgatgcggcgcaggcgctggacgccgagctg
cgcgaacaagtcggcggcctgcagcacagcatgcgtgaagccaccgatctgaacagcctc
aagcgggtggtggaggcgcgtctggatggcctgctggacaccgtcgacaactaccgtcgc
cagcgcagcgagcaggagcagaaactgggcgagcgcctgcagcagctggtcagccgtgtc
ggcagcctggaacaggcggcacgggggctgcgcggccatctggaagagcagcggcagaag
gccctgcaggacccgctgaccggactgcccaaccgggcggcatggaatgaacggctggat
ctcgaattcgcccgctggcaacgctacggtggcgatctgccgctggccgtgctggatgtc
gatcacttcaagcgggtcaacgacggctatggccatctggccggcgatcgggtgctgaag
atcatcggcacggagctgcagaggcggttgcgcaagaccgacttcatcgcccgtttcggt
ggtgaggagttcgtcgtgctgttgcccaacacgccttacgaggcggggcggcagctgatt
gaaacgctgcgcgagtccatcggcagttgcccgttccacttcaagggcgagcgggttgcc
atcaccctgtccgccggtttgacggcattcgttactggcgacaccgccgagcgtgccttc
gagcgtgccgaccgggcgctctaccgcgccaaggattcgggacgcaatcgtgtcgagcca
gcctga

DBGET integrated database retrieval system