KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4075Help
Entry
PSTAB_4075        CDS       T01571                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_4075
Enzymes [BR:psz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSTAB_4075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4399338..4400240
Genome map
AA seq 300 aa AA seqDB search
MPVDIQRIEMNQLACWRLRRGEDELLIAEQGAQILNYRQGDAPPIIWLSEEAAFEQGQSV
RGGVPVCWPWFGDLARNPQEVQASYHGEQPAPFHGLVRALPWQLREQRGEGDTAILEFHC
PQALGALPGWPHRVELTLQIRLADELELSLSSRNVSTQAVTISQALHSYFAVGDIHQVRV
EGLAGCPYIDTLLDWQQRQQQNGDLAFNGETDRIYLQLPTTLRLVDPAWKRSIQLTTRGS
RSAVLWNPWIDKAKRLSSFAGDAWQRMACIETANVLDDAMVLQPGEQHLLGVSVTAIPAR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgatatccaacgcatcgaaatgaaccagctcgcctgctggcgactacgccgc
ggtgaggacgaactgctgatcgccgaacagggcgcgcagatcctcaactatcgccagggc
gatgcgccgccgatcatctggctcagcgaggaggccgccttcgaacagggccaatcggta
cgcggaggcgtacccgtatgctggccgtggttcggcgatctggcgcgcaacccacaagag
gtccaggcgagctaccacggcgagcaacccgcgcccttccacggcctggtgcgcgccctg
ccctggcaactgcgggagcagcgcggcgaaggcgatacggcgattctcgagttccactgc
ccgcaggcgctcggcgcactgccgggctggccgcaccgggtcgaactgacactgcagatc
cgcctggccgacgagctggagctcagcctcagcagccgcaacgttagcacgcaggcagtc
accatcagccaggccctgcacagctacttcgccgtcggcgacatccatcaggttcgcgtc
gaaggcctggccggctgcccctacatcgatacgctgctggattggcagcagcgccagcag
cagaacggagacctggcgttcaacggcgaaaccgaccgcatctacttgcagctcccgaca
acgttgaggctcgtcgacccggcatggaaacgcagcatccagctgaccacccgcggctcg
cgatcagcggtgctgtggaacccctggatcgacaaggccaagcgcctgtccagcttcgcc
ggcgacgcctggcagcgcatggcctgcatcgagacagccaatgtgctggacgacgcaatg
gtcttgcagccgggcgagcagcacctgttgggcgtatccgtcaccgcaatccctgcgcgc
tga

DBGET integrated database retrieval system