KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4075Help
Entry
PSTAB_4075        CDS       T01571                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:psz00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4399338..4400240
Genome map
AA seq 300 aa AA seqDB search
MPVDIQRIEMNQLACWRLRRGEDELLIAEQGAQILNYRQGDAPPIIWLSEEAAFEQGQSV
RGGVPVCWPWFGDLARNPQEVQASYHGEQPAPFHGLVRALPWQLREQRGEGDTAILEFHC
PQALGALPGWPHRVELTLQIRLADELELSLSSRNVSTQAVTISQALHSYFAVGDIHQVRV
EGLAGCPYIDTLLDWQQRQQQNGDLAFNGETDRIYLQLPTTLRLVDPAWKRSIQLTTRGS
RSAVLWNPWIDKAKRLSSFAGDAWQRMACIETANVLDDAMVLQPGEQHLLGVSVTAIPAR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgatatccaacgcatcgaaatgaaccagctcgcctgctggcgactacgccgc
ggtgaggacgaactgctgatcgccgaacagggcgcgcagatcctcaactatcgccagggc
gatgcgccgccgatcatctggctcagcgaggaggccgccttcgaacagggccaatcggta
cgcggaggcgtacccgtatgctggccgtggttcggcgatctggcgcgcaacccacaagag
gtccaggcgagctaccacggcgagcaacccgcgcccttccacggcctggtgcgcgccctg
ccctggcaactgcgggagcagcgcggcgaaggcgatacggcgattctcgagttccactgc
ccgcaggcgctcggcgcactgccgggctggccgcaccgggtcgaactgacactgcagatc
cgcctggccgacgagctggagctcagcctcagcagccgcaacgttagcacgcaggcagtc
accatcagccaggccctgcacagctacttcgccgtcggcgacatccatcaggttcgcgtc
gaaggcctggccggctgcccctacatcgatacgctgctggattggcagcagcgccagcag
cagaacggagacctggcgttcaacggcgaaaccgaccgcatctacttgcagctcccgaca
acgttgaggctcgtcgacccggcatggaaacgcagcatccagctgaccacccgcggctcg
cgatcagcggtgctgtggaacccctggatcgacaaggccaagcgcctgtccagcttcgcc
ggcgacgcctggcagcgcatggcctgcatcgagacagccaatgtgctggacgacgcaatg
gtcttgcagccgggcgagcagcacctgttgggcgtatccgtcaccgcaatccctgcgcgc
tga

DBGET integrated database retrieval system