KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4136Help
Entry
PSTAB_4136        CDS       T01571                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PSTAB_4136 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_4136 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSTAB_4136 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSTAB_4136 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSTAB_4136 (adhA)
   00626 Naphthalene degradation
    PSTAB_4136 (adhA)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSTAB_4136 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4464682..4465665)
Genome map
AA seq 327 aa AA seqDB search
MRAMLLEQIGQPLQLRELPVPQPGPGEVRVRVLACGVCRTDLHVVDGELPEAPLPIIPGH
EIVGRVDALGEGVTGFEPGQRVGIPWLGHTCGTCSYCQHAEENLCDAPQFTGYTRPGGYA
EYVVADARFVFALGEEGDPVALAPLLCAGLIGWRSLVKAGDGKRLGLYGFGAAAHIVMQV
ARWQGRDVYAFSRPGDVAAQDFARSLGAVWAGDSGELPPVPLDAAIIYAPAGELVPAALR
ALRKGGRVVCAGIHMSDIPSFPYNILWQEREVVSVANLTRQDGLEFFPVAAQVGIHTETH
AYPLEQANQALDDLRNGRFQGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccatgttgctggaacagattggccaacccctgcagctgcgcgagctgcccgtg
ccgcaaccggggcctggcgaggttcgcgtgcgggtgctggcctgtggcgtctgccgcacc
gatctgcacgtggtcgacggcgaactgccggaggcgccgctgccgatcattcccggccac
gagatcgtcgggcgggtcgacgccttgggcgagggcgtgaccggcttcgagccgggccag
cgggtcggcattccctggctggggcacacctgcggcacctgcagctactgccagcacgcc
gaggaaaacctctgcgacgcgccgcagttcaccggttacacgcggcccggcggctacgcc
gaatacgtggtggccgatgcccgtttcgtttttgccctcggcgaggagggcgaccccgtg
gcgctggcaccgctgctctgcgccgggctgatcggctggcgttcgctggtcaaggccggt
gacggcaagcgtctcgggctgtacggcttcggtgccgcggcgcatatcgtcatgcaggtg
gcgcgctggcaggggcgcgatgtgtatgccttcagccgcccgggcgatgtggcggcgcag
gacttcgcccgttcgctgggcgcggtctgggccggtgattcgggcgagctgccgccggtg
ccgctggatgcggcgatcatctatgcgccggcgggcgagctggtgccggccgcgttgcgc
gcgctgcgcaagggcggccgggtggtctgcgccggcatccacatgagcgatatcccgagc
tttccctacaacatcctctggcaggagcgcgaggtggtctcggtggccaatctcacccgc
caggacggcctggagttctttccggtggccgcccaggtcggcatccataccgaaacccac
gcctacccgctggagcaggccaaccaggcactggatgacctgcgcaacgggcgtttccag
ggtgctgcggtgctggtgccctag

DBGET integrated database retrieval system