KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4136Help
Entry
PSTAB_4136        CDS       T01571                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00010  Glycolysis / Gluconeogenesis
psz00071  Fatty acid degradation
psz00350  Tyrosine metabolism
psz00625  Chloroalkane and chloroalkene degradation
psz00626  Naphthalene degradation
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_4136 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSTAB_4136 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSTAB_4136 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSTAB_4136 (adhA)
   00626 Naphthalene degradation
    PSTAB_4136 (adhA)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSTAB_4136 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DUF1442
Motif
Other DBs
NCBI-ProteinID: AEJ07417
UniProt: F8H6U3
Position
complement(4464682..4465665)
Genome map
AA seq 327 aa AA seqDB search
MRAMLLEQIGQPLQLRELPVPQPGPGEVRVRVLACGVCRTDLHVVDGELPEAPLPIIPGH
EIVGRVDALGEGVTGFEPGQRVGIPWLGHTCGTCSYCQHAEENLCDAPQFTGYTRPGGYA
EYVVADARFVFALGEEGDPVALAPLLCAGLIGWRSLVKAGDGKRLGLYGFGAAAHIVMQV
ARWQGRDVYAFSRPGDVAAQDFARSLGAVWAGDSGELPPVPLDAAIIYAPAGELVPAALR
ALRKGGRVVCAGIHMSDIPSFPYNILWQEREVVSVANLTRQDGLEFFPVAAQVGIHTETH
AYPLEQANQALDDLRNGRFQGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccatgttgctggaacagattggccaacccctgcagctgcgcgagctgcccgtg
ccgcaaccggggcctggcgaggttcgcgtgcgggtgctggcctgtggcgtctgccgcacc
gatctgcacgtggtcgacggcgaactgccggaggcgccgctgccgatcattcccggccac
gagatcgtcgggcgggtcgacgccttgggcgagggcgtgaccggcttcgagccgggccag
cgggtcggcattccctggctggggcacacctgcggcacctgcagctactgccagcacgcc
gaggaaaacctctgcgacgcgccgcagttcaccggttacacgcggcccggcggctacgcc
gaatacgtggtggccgatgcccgtttcgtttttgccctcggcgaggagggcgaccccgtg
gcgctggcaccgctgctctgcgccgggctgatcggctggcgttcgctggtcaaggccggt
gacggcaagcgtctcgggctgtacggcttcggtgccgcggcgcatatcgtcatgcaggtg
gcgcgctggcaggggcgcgatgtgtatgccttcagccgcccgggcgatgtggcggcgcag
gacttcgcccgttcgctgggcgcggtctgggccggtgattcgggcgagctgccgccggtg
ccgctggatgcggcgatcatctatgcgccggcgggcgagctggtgccggccgcgttgcgc
gcgctgcgcaagggcggccgggtggtctgcgccggcatccacatgagcgatatcccgagc
tttccctacaacatcctctggcaggagcgcgaggtggtctcggtggccaatctcacccgc
caggacggcctggagttctttccggtggccgcccaggtcggcatccataccgaaacccac
gcctacccgctggagcaggccaaccaggcactggatgacctgcgcaacgggcgtttccag
ggtgctgcggtgctggtgccctag

DBGET integrated database retrieval system