KEGG   Paenibacillus terrae: HPL003_00150Help
Entry
HPL003_00150      CDS       T01668                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pta  Paenibacillus terrae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPL003_00150
Enzymes [BR:pta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HPL003_00150
Exosome [BR:pta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPL003_00150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(36298..37296)
Genome map
AA seq 332 aa AA seqDB search
MSVPFTRHRRLRQSAAIRSMVRETVLNPADFIQPIYVTFGTGVKQEISSMPGVYRFSLDQ
LEEELKEISELGIPAVLLFGIPETKDSLGTSAFVDDGIVQEATRLIKSRYPELLVVADTC
LCEFTDHGHCGMVHMHEHDGEVCGEVLNDESLEVLVRTAVSQARAGADIIAPSNMMDGFV
QAIRQGLDEEGLSHIPIMSYSVKYASAFYGPFREAADSAPQFGDRKSYQMDPANAREALR
EAESDVLEGADMLMVKPSLSYLDVMRTIKDQFDLPMVAYNVSGEYAMVKAAALQGWIDEK
AMVLEILTSMKRAGADMIITYSAKDAARWLKQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttccttttaccagacatcgccgtttgcgtcaatctgctgctatccgcagtatg
gtacgtgagacggtattgaatcccgctgattttatccagccgatctatgtaacattcggt
acaggagtgaagcaggaaatcagctccatgccgggtgtgtaccgattttctctggaccaa
ttggaagaagaactgaaagaaattagtgagctcggcattcctgccgtgctcctgtttggc
attccggagacgaaggatagcttaggcacttcggcttttgtggacgatggtattgttcag
gaagctacacgtctgatcaagtcgcgttatcccgagctgctggttgtggctgacacttgt
ttgtgcgagtttacggatcatgggcactgcggtatggtccacatgcatgagcatgatggc
gaggtatgtggtgaagtgctgaatgacgaatctctggaggtgctggtacgtacagccgtt
tctcaagccagagcgggcgctgatattattgcgccatccaatatgatggacggctttgtg
caagcgattcgacaagggctggatgaggaaggcttatcgcatattccgattatgtcgtat
tccgtcaaatatgcgtctgctttttatggtcctttccgggaagcggcagattctgcaccg
caattcggtgaccgcaaatcctatcagatggaccctgctaatgcacgtgaagcattgcga
gaagcagaatcggacgtgctggaaggtgcggatatgctgatggtgaagccatccctctcg
tacctggatgtgatgcgtacaatcaaagaccagtttgatctgcctatggtggcttacaac
gtcagcggtgaatacgcgatggtcaaggcggcagctcttcaaggctggattgatgaaaaa
gcgatggtgctggagattttgacgagcatgaaacgcgcaggtgcagacatgattattacc
tattccgccaaggatgcggcaagatggttgaagcaataa

DBGET integrated database retrieval system