KEGG   Paenibacillus terrae: HPL003_00285Help
Entry
HPL003_00285      CDS       T01668                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pta00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71127..72584)
Genome map
AA seq 485 aa AA seqDB search
MTKILKGFPKNFLWGGATAANQLEGAFDVDGKGLSSADVIAYVPKAERTNDHAIEISSER
LEDILSGKVNARFPKREGVDFFHHYKEDIALFAEMGFKVFRMSIHWSRIFPNGYDAEPNE
AGLQFYDNVFDELRKYGIEPLVTLSHYETPLGLTQKYNGWLGREVIQHYVNYAETVFTRY
KDKVKYWLTFNEINVMTMSPFTGGGVVIDRVDNKQQAIYQALHHQFVASALATKRGHEII
PGSQIGCMLARMESYAHTCNPEDVLKSQHENQMNLFFTDVHARGEYSNYMNRYFEENNIV
LHTEPGDAEILKNNTVDYISFSYYMTLTVSAGPEGEKAAGNLIGGVKNPYLQSSDWGWQI
DPIGLRVTLNTLYDRYQKPLFIVENGLGAYDKVEEDGSIHDTYRIDYLRQHIAQMKEAIA
DGVDLIGYTSWGPIDLVSMSTSEMSKRYGFIYVDLDDDGNGTLKRSKKDSFDWYKNVIAT
NGEEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactaagatattaaaaggatttccgaaaaactttctgtggggcggggcaaccgcagct
aaccaattggaaggcgcttttgatgtagatggaaaaggattgtccagtgcggacgtgatc
gcctatgtacccaaagcagagcgcacaaacgatcatgctatagagatttcgtccgagcga
ctcgaggatattttgtctggtaaggtaaatgcccgttttccaaagcgcgaaggtgtagac
tttttccatcattacaaagaagatatcgcattatttgcggaaatgggctttaaggtattc
cgcatgtccatccactggtcgcggattttcccgaatggatatgatgccgagccgaatgaa
gcaggcttgcaattctacgataatgtatttgacgagctgcgcaagtatgggatagagcca
ctggtgacattgtcccattacgaaacaccgctaggtcttacacagaaatataatggctgg
ctgggtcgtgaagtgatacagcactacgtaaattatgctgaaactgtgtttacacgttat
aaggataaagtgaaatactggctgacttttaatgaaatcaatgtgatgacgatgagtccg
ttcacaggtggcggtgtggtcattgaccgtgtagataacaagcagcaagcgatctaccaa
gccctgcatcaccagtttgtggcgagcgcattagcaacaaaacgaggccatgagattatt
cctggctctcaaatcggctgtatgctggctcgtatggaaagctatgcacatacgtgtaac
ccggaggacgtgctgaaaagtcagcatgaaaaccaaatgaatctgttctttacggatgta
catgcccgtggggaatattcaaattatatgaaccgttattttgaagagaataatattgtt
ttgcacacagaacccggcgatgccgaaattctgaaaaacaacacggtcgattacatctca
ttcagctattatatgaccttgactgtctcagcaggtccggaaggcgagaaggcagcgggg
aacctgattggcggcgttaaaaatccgtatttacaatcctctgactggggctggcagatt
gatccgatcggcctgcgtgttacgctgaacacattatatgaccgctatcaaaagccgctg
ttcatcgtggaaaacggcttgggtgcatatgacaaggtggaagaagacggctccattcac
gacacgtatcgcattgattatttgcgccagcatattgcccaaatgaaggaagcgattgcg
gacggtgtggatttgattggttacaccagttgggggcctatcgaccttgtgagcatgtct
acttccgaaatgtccaagcgttacggatttatttatgttgatctggacgatgacggtaac
ggaacactgaagcgctccaagaaggattcttttgactggtacaaaaatgtaattgccact
aacggcgaagaactgtaa

DBGET integrated database retrieval system