KEGG   Paenibacillus terrae: HPL003_04210Help
Entry
HPL003_04210      CDS       T01668                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pta  Paenibacillus terrae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPL003_04210
   00052 Galactose metabolism
    HPL003_04210
   00500 Starch and sucrose metabolism
    HPL003_04210
   00520 Amino sugar and nucleotide sugar metabolism
    HPL003_04210
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPL003_04210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(861276..862172)
Genome map
AA seq 298 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVASGIEDIIIVTGKGK
RAIEDHFDYSFELEHNLAAKEKWNLLNEVRKPSEMADIHYIRQKEPKGLGHAIWCARKFI
GDEPFAVLLGDDIVESENPCLKQMIDVFDEYQRSVVGVKQVDWNEVHRYGIVEGHALTSK
ISEAERLVEKPKKEEATSNLAIMGRYILTPDIFDILGQQSAGVGGEIQLTDALSKLGEKN
PILAYEFDGNRHDVGEKLGFIETTIHYALQHNEIKDEVLAYMRQVIEEIDQQKQVKLQ
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgaaaagcgattattcctgctgcgggattaggaacccgttttcttcctgct
accaaagcgatgcccaaagaaatgcttccgattgtagataagccaaccattcaatatatt
attgaagaggctgtagcatctgggattgaagatattattatcgttactggtaaaggtaaa
cgagcgattgaggatcattttgactattcatttgagctggagcataatctggccgccaag
gaaaagtggaatctgctcaatgaggtgcgcaagccatcagaaatggcagacatacactac
atccgccaaaaggagcccaaaggcttaggtcacgctatatggtgtgcacgtaaattcata
ggggatgagccttttgctgtacttttaggtgatgacatcgttgagtctgagaatccatgt
ctcaaacagatgatagacgttttcgacgagtatcagcgttcggttgtaggtgtaaagcaa
gtggattggaacgaggttcatcgttacgggattgttgaggggcatgcacttacttcgaag
atctcagaggcagaacggttggtggagaagccgaagaaagaagaagcaacctccaacttg
gcgatcatgggacgctatatcttgacgccagatattttcgacatccttggtcagcaatcc
gctggagtaggcggggagattcaattgacggatgcattgtccaagctgggtgaaaagaat
ccgatcctagcctatgaatttgatgggaaccgtcatgatgttggggagaagttgggattc
attgaaacaaccatccattatgccctgcagcataacgaaattaaagatgaagtattggct
tatatgagacaggtcatagaagagattgatcaacaaaaacaggtgaagctgcaatag

DBGET integrated database retrieval system