KEGG   Paenibacillus terrae: HPL003_05835Help
Entry
HPL003_05835      CDS       T01668                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00260  Glycine, serine and threonine metabolism
pta00680  Methane metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
pta01230  Biosynthesis of amino acids
Module
pta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pta_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_05835 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HPL003_05835 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPL003_05835 (gpmA)
Enzymes [BR:pta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HPL003_05835 (gpmA)
Membrane trafficking [BR:pta04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HPL003_05835 (gpmA)
Exosome [BR:pta04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HPL003_05835 (gpmA)
  Exosomal proteins of melanoma cells
   HPL003_05835 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AET57932
UniProt: G7VZS1
Position
complement(1223122..1223871)
Genome map
AA seq 249 aa AA seqDB search
MYQVVLVRHGESVYNRQNLFTGWTDVDLTEQGTHEAIEAGRILKEAGYTFDLAFASVLKR
SIRTLYHILDELDDLWIPVQKSWKLNERHYGALQGLSKLDSAVQYGEEQVHIWRRSLTVR
PPMLDEQDERSPHREERYRNIKPEELPLGESLEDTVHRVGEFWKQRIVPLVQKKERVIIS
AHGNTLRALIKYMENLDETALLDLNIPTGIPLVYELDEHIDPIRRFYLGDPSHVEAKKQA
VANQGKVTE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagtggtgctggtgaggcatggagaaagcgtatataaccgtcaaaatctgttc
acaggctggacggatgtggacctgaccgagcagggaacccatgaagccatagaggcgggc
cgtattctcaaggaggccgggtatacgtttgatctggcgttcgcttcggtgctaaaacga
tccattcgtacgctgtatcacattttggacgagctggatgatttgtggatacccgtgcag
aagtcgtggaaactgaacgaacgccattatggtgctcttcagggactcagcaagctggat
tctgccgtccaatacggcgaggagcaggttcatatctggcggcgcagcctgacggtgcgg
cctcctatgctggatgaacaggatgaacgcagtcctcacagggaggaacgataccgtaac
attaagccggaggagctaccgcttggggaaagtttggaggataccgtgcatcgggtcggt
gagttttggaagcagcggattgtacccttggtgcaaaaaaaggaacgggtcattatttcc
gcgcatggcaacaccctgcgggcattgatcaagtatatggagaatttggacgaaaccgcc
ctgctggatttgaatatcccgacaggcattccgctggtatacgagctggacgagcatata
gatcccattcggcgcttctatctcggtgatccgagtcatgtggaggcgaaaaaacaggcc
gtggctaaccaaggcaaggtgacggagtga

DBGET integrated database retrieval system