KEGG   Paenibacillus terrae: HPL003_05835Help
Entry
HPL003_05835      CDS       T01668                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPL003_05835 (gpmA)
   01230 Biosynthesis of amino acids
    HPL003_05835 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_05835 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HPL003_05835 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPL003_05835 (gpmA)
Enzymes [BR:pta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HPL003_05835 (gpmA)
Exosome [BR:pta04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HPL003_05835 (gpmA)
  Exosomal proteins of melanoma cells
   HPL003_05835 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223122..1223871)
Genome map
AA seq 249 aa AA seqDB search
MYQVVLVRHGESVYNRQNLFTGWTDVDLTEQGTHEAIEAGRILKEAGYTFDLAFASVLKR
SIRTLYHILDELDDLWIPVQKSWKLNERHYGALQGLSKLDSAVQYGEEQVHIWRRSLTVR
PPMLDEQDERSPHREERYRNIKPEELPLGESLEDTVHRVGEFWKQRIVPLVQKKERVIIS
AHGNTLRALIKYMENLDETALLDLNIPTGIPLVYELDEHIDPIRRFYLGDPSHVEAKKQA
VANQGKVTE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagtggtgctggtgaggcatggagaaagcgtatataaccgtcaaaatctgttc
acaggctggacggatgtggacctgaccgagcagggaacccatgaagccatagaggcgggc
cgtattctcaaggaggccgggtatacgtttgatctggcgttcgcttcggtgctaaaacga
tccattcgtacgctgtatcacattttggacgagctggatgatttgtggatacccgtgcag
aagtcgtggaaactgaacgaacgccattatggtgctcttcagggactcagcaagctggat
tctgccgtccaatacggcgaggagcaggttcatatctggcggcgcagcctgacggtgcgg
cctcctatgctggatgaacaggatgaacgcagtcctcacagggaggaacgataccgtaac
attaagccggaggagctaccgcttggggaaagtttggaggataccgtgcatcgggtcggt
gagttttggaagcagcggattgtacccttggtgcaaaaaaaggaacgggtcattatttcc
gcgcatggcaacaccctgcgggcattgatcaagtatatggagaatttggacgaaaccgcc
ctgctggatttgaatatcccgacaggcattccgctggtatacgagctggacgagcatata
gatcccattcggcgcttctatctcggtgatccgagtcatgtggaggcgaaaaaacaggcc
gtggctaaccaaggcaaggtgacggagtga

DBGET integrated database retrieval system